Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000001 (Gnai3)
Chromosomal location
Chr 3: 107910199 - 107949007 (-)
Description
guanine nucleotide binding protein (G protein), alpha inhibiting 3 Gene [Source:MGI (curated);Acc:Gnai3-001]
RefSeq_dna
NM_010306 
RefSeq_peptide
NP_034436.1 
UniGene
Mm.271703 Mm.469993 
MGI
MGI:95773 
Uniprot/SWISSPROT
Q9DC51 
Uniprot/SPTREMBL
A2AE36 Q3TJH1 
Human Ortholog
ENSG00000065135 (GNAI3)
Omim not available
UniTrap UNI452
Vector Insertion
Chr 3: 107926756 - 107948805
Public Clones DC0121 (sanger) CSD244 (baygenomics) YTA473 (baygenomics) CSH696 (baygenomics)
RRX057 (baygenomics) YTA048 (baygenomics) CSH700 (baygenomics) YTA187 (baygenomics)
W095F08 (ggtc)
Private Clones OST249171 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8178
Vector Insertion
Chr 3: 107921377 - 107926459
Public Clones RRH166 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9377
Vector Insertion
Chr 3: 107912531 - 107914852
Public Clones XH068 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000000001
Sequence
AGAAGACCCGTCTCCGCCGGTGTGTGGCGATTCCCGCGGTGTGTGTGAGTGAGCCCGGGCCCGGTCCCCTCTCCCGCCGCCGCCATGGGCTGCACGTTGA

GCGCCGAGGACAAGGCGGCGGTGGAGCGGAGCAAGATGATCGACCGCAACTTGCGGGAGGACGGGGAGAAAGCGGCCAAAGAAGTGAAGCTGCTGCTGCT

CG - UNI452 - GCGCTGGAGAATCTGGTAAAAGTACCATCGTGAAACAGATGAA AATCATTCATGAGGACGGCTATTCAGAGGACGAATGTAAACA

GTATAAAGTAGTTGTCTACAGCAATACTATTCAGTCCATCATTGCAATCATACGAGCCATGGGACGGTTGAAGATTGATTTTGGGGAATCTGCCAGAGCA

 - UNI8178 - GATGATGCCCGACAGTTATTTGTTTTAGCTGGGAGTGCTGAAGAAGGAGTCATGACTTCAGAACTAGCAGGCGTGATTAAACGTTTA

TGGCGAGATGGCGGGGTACAGGCATGCTTTAGCAGGTCCAGGGAATATCAGCTCAATGATTCTGCTTCATA CTACCTAAATGATTTGGATAGAATATCC

CAGACCAACTACATTCCAACTCAGCAAGATGTTCTTCGGACAAGAGTGAAGACTACAGGCATTGTGGAGACCCACTTCACCTTCAAGGAACTCTACTTCA

A AATGTTTGATGTAGGTGGCCAAAGATCCGAACGAAAAAAGTGGATTCACTGTTTTGAGGGAGTGACAGCAATTATCTTTTGTGTGGCTCTCAGTGATT

ACGACCTTGTTCTGGCTGAGGATGAGGAAATG AACCGAATGCATGAAAGCATGAAATTGTTTGACAGCATTTGTAACAACAAATGGTTTACAGACACTT

CAATCATTCTCTTTCTTAATAAGAAAGACCTTTTTGAGGAAAAAATAAAGAGGAGTCCATTAACAATCTGTTATCCAGAATACACAG - UNI9377 - 

GTTCCAATACATACGAAGAGGCAGCTGCTTACATTCAGTGCCAGTTTGAAGATCTGAACCGAAGAAAAGATACCAAGGAGGTCTACACTCACTTCACCTG

TGCCACAGACACCAAAAATGTGCAGTTTGTTTTTGATGCTGTTACGGATGTCATCATTAAAAACAACTTAAAGGAATGTGGGCTTTATTGAGAGGATGGC

ATAGTAAAAG CTATTACAGGGAGGAGTGTTGAGACCAGATGTCATCTACTGTCTCTTGGGTCAGCAGCACGCATGACAGGACCAAGGAATGGCAGCAAC

ACGCAGAATCTTAGCTAGCGCTCTCCAGCAGTCTTCTCTATTAGGGAATGTCTAATTGGCATGAGATGTTCAAATCAGACCTGGGATTGGACAACTGTAA

AGTATGACTGGATCGTCAGGGCGTCGCTTGGACTCTGTAATCTAATGTTTAGGGCATATTGAAGTTGAGGTGCTGCCTTCCAGAACTTAAACATGTAGCT

CACTTTCCCCCATCTTTTTGACAAATGACCAGTAGTTAATTTCTAAGGTTTTTCTTATCAAGAGAAGAATACTTAAAAACTCTTCCTTGTTTGCAAAAGA

AACTTCTGAGGACTGAGTCTTAACTATGCACACAATGTCACCAGACATCTTGAAACTATTCCTCTTAGTAGGAACTGTTTGTTTTTAACTCTTGGAATGG

TCGGGAGTAATATTTCAATAATTAAAATTCTTCCTGGTTATTGGGACTATATTAATAGAGCTTTTCGGAATGAAATTTATGTTACTGTCATGTTTAAAGT

ACCACAATGGTTTCTAAACAGCATTCACCTTGGAGAGTTCTACAGTACGATTCCTGCTCTCATTGCTTTACGCTTACGGTTGGAAGTTGTATTTGTCGGG

GTTAACCTTGTTTGTGCTGATTACCAAATTACTAGATGAATACTGATGTAGTGTGTTAAACTGCTTCTTGGACACACGCAGGATAGCCGTCAATGAGATG

CAGATGCTAAATTGAGAACCAGTGGCTTGCTGCTACAGGTCTACTAAGTTGACCACATGGAATCTTGCCTGTTTGTCTCGGTCATGGGGAGGTTTTGAAT

AAGATGCCCCTTGTTTTCCATCTTCGTGGCCTTTTTTGTTAGGAGACATCTAAAAGTGTATTAACAGTGCATGCTTTTCCTTTGTAAATGTGGTGCCAAA

TCCCTGTTTGCCATCGTTTTTACTGTAGCAATGTTAACTGTAGTAGTAGTCCTTACTATATTCTTTTTCTAAAACTTGCATTTGGGGACTTTTTCCACCT

TGTCGTGTACAGATTTGAATCTGTTACAGTTGGCAGCAGTATTAAAACAAACGGTGAGTGAAGAGCCTACGGTTGCTCCGTGCATAACTAGTTCTTTCTG

GGGATCCTGTCTGTCTCTTTTTTCCCCTGACCTCTGTCTGAGAGTGGATTTATTAGGTAGAAAAGTGTCTTTGAAAGTCTAGCTCCTTGATGTAATAGTA

TTACCAAGTCAGGACTGAGGGCTTTATGTGCAGTCCGTGTACAAGAGGAAAGTCACAATCCGGCTTTCGGATGTGTACAGTTTGCTTGTGCTGAGAGCTA

CAGTCCTTTTGTACAGTATATATCAAATGTCATTAAACACTGAGTGGACACTGAGGGACAGCAAACAATGCATTTGGAGCATTTCAGATCAGTAGTTTGA

TCAGTGCCTTTTGAGGTCCAGTCGCTGTGGCTCGGATCCATTCATCTCTATGTTACCTCCTACTCGTTTGAAAGAAGGTTGATGGTCAGAACTGCTTCAG

AAGCAAGCCACGGTGATCAGTGCCTTTGTTGGCAGCTTTTACAATTTTTAATTCTTACGTGTTTTGCAAAATCATTATTATGCAGACAGTATAACTGTTA

TCTTACAAATATTTCGTTAGGGCTAGGAAAATGTCACTTGAAAGAAAGAAAAGTATTGATTTCAATCGGCGATTGACTCAATTCCCACAATGTAGGGGCT

AATAAGTCTTACTCTGAATTTATCTTTCCTTTGTTGTATTCTGTAATATAAGAACATCTGGTGAAATATTGTTTTCATAATTTTTCTATACTTTGGGTTT

AATAAAATGGTGTTGATAATCTAAAATATTAGATAATCCAAATTTAATTTTACTTCAGAATGCATTTTGTATTTTCATTTGAATCTGTCTATTTTTTAAA

CCTTTCTGTTAATTAAAAATAGAAGTTCTTCACTTCTTTGTCTCTGC
Translation
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLG - UNI452 - GAGESGKSTIVKQMK KIIHEDGYSEDECKQYKVVVYSNTIQSIIAII

RAMGRLKIDFGESARA - UNI8178 - DDARQLFVLAGSAEEGVMTSELAGVIKRLWRDGGVQACFSRSREYQLNDSASY YYLNDLDRISQTNYIPT

QQDVLRTRVKTTGIVETHFTFKELYFK KMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM NRMHESMKLFDSICNNKWFTDTSIILF

LNKKDLFEEKIKRSPLTICYPEYTG - UNI9377 - GSNTYEEAAAYIQCQFEDLNRRKDTKEVYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGL

Y 

For any suggestions or comments, please send an email to unitrap@crg.es