Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000031 (H19)
Chromosomal location
Chr 7: 149761437 - 149764022 (-)
Description
H19 fetal liver mRNA Gene [Source:MGI Symbol;Acc:MGI:95891]
UniGene
Mm.14802 
MGI
MGI:95891 
Uniprot/SPTREMBL
Q61639 
Human Ortholog
not available
Omim not available
UniTrap UNI28386
Vector Insertion
Chr 7: 149762020 - 149762107
Public Clones not available
Private Clones OST32355 (lexicon)
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000000031
Sequence
GGGTGGGGGGTATCGGGGAAACTGGGGAAGATGGGAGAGCTGGAGGAGAGTCGTGGGGTCCGAGGAGCACCTCGGCATCTGGAGTCTGGCAGGAATGTTG

AAGGACTGAGGGGCTAGCTCAGGCAGAGCAAAGGCATCGCAAAGGCTGGAAAACATCGGAGTGAAGCTGAAGGGCCTGAGCTAGGGTTGGAGAGGAATGG

GGAGCCAGACATTCATCCCGGTTACTTTTGGTTACAGGACGTGGCGGCTGGTCGGATAAAGGGGAGCTGCTGGGAAGGGTTCGACCCCAGACCTGGGCAG

TGAAGGTATAGCTGGCAGCAGTGGGCAGGTGAGGACCGCCGTCTGCTGGGCAGGTGAGTCTCCTTCTTCTCTCTTGGCCTCGCTCCACTGACCTTCTAAA

CGAAGGTTTAGAGAGGGGGCCTGGTGAGAAGAAGCGGCTGGCCTCGCAGCAGAATGGCACATAGAAAGGCAGGATAGTTAGCAAAGGAGACATCGTCTCG

GGGGGAGCCGAGACAGAAGGAGGCTGGGGGACCATTGGCGACCCCAGGTGGAAAGAGCTCTTAGAGAGAAGAAAGAAGAGGTGCAGGGTTGCCAGTAAAG

ACTGAGGCCGCTGCCTCCAGGGAGGTGATAGGAGTCCTTGGAGACAGTGGCAGAGACCATGGGATCCAGCAAGAACAGAAGCATTCTAGGCTGGGGTCAA

ACAGGGCAAGATGGGGTCACAAGACACAGATGGGTCCCCAGCCGCCACAACATCCCACCCACCGTAATTCACTTAGAAGAAGGTTCAAGAGTGGCTCTGG

CAAAGTCCCAAGTTTGCCAGAGCCTCAATAACTGGAGAATGGAAAAGAAGGGCAGTGCAGGGTGTCACCAGAAGGGGAGTGGGGGCTGCAGGTATCGGAC

TCCAGAGGGATTTTACAGCAAGGAGGCTGCAGTGGGTCCAGCCTGCAGACACACCATTCCCATGAGGCACTGCGGCCCAGGGACTGGTGCGGAAAGGGCC

CACAGTGGACTTGGTACACTGTATGCCCTAACCGCTCAGTCCCTGGGTCTGGCATGACAGACAGAACATTTCCAGGGGAGTCAAGGGCACAGGATGAAGC

CAGACGAGGCGAGGCAGGCGGGGCAGAATGAATGAGTTTCTAGGGAGGGAGGTTGGGTGCAGGTAGAGCGAGTAGCTGGGGTGGTGAGCCAGGGAGGCAC

TGGCCTCCAGAGTCCGTGGCCAAGGAGGGCCTTGCGGGCGGCGACGGAGCAGTGATCGGTGTCTCGAAGAGCTCGGACTGGAGACTAGG CCAGGTCTCC

AGCAGAGGTGGATGTGCCTGCCAGTCACTGAAGGCGAGGATGACAGGTGTGGTCAATGTGACAGAAAGACATGACATGGTCCGGTGTGATGGAGAGGACA

GAAGGGCAGTCATCCAGCCTTCTTG AACACCATGGGCTGGCGCCTTGTCGTAGAAGCCGTCTGTTCTTTCACTTTTCCCAAAGAGCTAACACTTCTCTG

CTGCTCTCTGGATCCTCCTCCCCCTACCTTGAACCCTCAAGATGAAAG AAATGGTGCTACCCAGCTCATGTCTGGGCCTTTGAATCCGGGGACTTCTTT

AAGTCCGTCTCGTTCTGAATCAAGAAGATGCTGCAATCAGAACCACTACACTACCTGCCTCAGGAATCTGCTCCAAG - UNI28386 - GTGAAGCTG

AAAGAACAGATGGTGTCAACATTTTGAAAGAGCAGACTCATAGCACCCACCCACCCCTGAGAATCCATCTTCATGGCCAACTCTGCCTGACCCGGGAGAC

CACCACCCACATCATCCTGGAGCCAAGCCTCTACCCCGGGATGACTTCATCATCTCCCTCCTGTCTTTTTCTTCTTCCTCCTTTCCTGTAATTCTGTTTC

TTTCCTTTTGTTCCTTCCTTGCTTGAGAGACTCAAAGCACCCGTGACTCTGTTTCCCCATTTACCCCCTTTTGAATTTGCACTAAGTCGATTGCACTGGT

TTGGAGTCCCGGAGATAGCTTTGAGTCTCTCCGTATGAATGTATACAGCGAGTGTGTAAACCTCTTTGGCAATGCTGCCCCAGTACCCACCTGTCGTCCA

TCTCCGTCTGAGGGCAACTGGGTGTGGCCGTGTGCTTGAGGCCTCGCCTTCCCCTCGCCTAGTCTGGAAGCAGTTCCATCATAAAGTGTTCAACATGCCC

TACTTCATCCTTTGCCCCTCCTCACCAGGGCCTCACCAGAGGTCCTGGGTCCATCAATAAATACAGTTACAGTC
Translation
  MGWRLVVEAVCSFTFPKELTLLCCSLDPPPPTLNPQDER RNGATQLMSGPLNPGTSLSPSRSESRRCCNQNHYTTCLRNLLQG - UNI28386 - 

GEAERTDGVNILKEQTHSTHPPLRIHLHGQLCLTRETTTHIILEPSLYPGMTSSSPSCLFLLPPFL

For any suggestions or comments, please send an email to unitrap@crg.es