Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000088 (Cox5a)
Chromosomal location
Chr 9: 57369105 - 57380230 (+)
Description
cytochrome c oxidase, subunit Va Gene [Source:MGI Symbol;Acc:MGI:88474]
RefSeq_dna
NM_007747 
RefSeq_peptide
NP_031773.2 
UniGene
Mm.398320 
MGI
MGI:88474 
Uniprot/SWISSPROT
P12787 
Human Ortholog
ENSG00000178741 (COX5A)
Omim not available
UniTrap UNI12427
Vector Insertion
Chr 9: 57369223 - 57376762
Public Clones (sanger) A029F02 (ggtc) IST14701E2 (tigm) IST10132G3 (tigm) IST10132F3 (tigm)
Private Clones OST458000 (lexicon) OST454398 (lexicon) OST404952 (lexicon) OST404943 (lexicon)
OST375450 (lexicon) OST352207 (lexicon) OST65964 (lexicon) OST63934 (lexicon)
OST62466 (lexicon) OST59362 (lexicon) OST48532 (lexicon) OST34691 (lexicon)
OST32905 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6537
Vector Insertion
Chr 9: 57376880 - 57378047
Public Clones CSE047 (baygenomics)
Private Clones OST424420 (lexicon)
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26458
Vector Insertion
Chr 9: 57378170 - 57379475
Public Clones not available
Private Clones OST116685 (lexicon)
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25410
Vector Insertion
Chr 9: 57379600 - 57380088
Public Clones not available
Private Clones OST184882 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000000090
Sequence
AGCCTCAGCCAGTGCGCTGTGGTCGCCGTCATGCTCGCCGCTGCCCTCCGTCGCTGTACCGCAGCCGCGGCTGCCCGAGGCCTCCTGCACCCCGCCTCGG

CTCCCAGCCCCGCCGCCG - UNI12427 - CTGTCTGTTCCATTCGCTGCTATTCTCATGGGTCACACGAGACAGATGAGGAGTTTGATGCTCGCTGG

GTGACATATTTCAACAAGCCAGACATTGATGCCTGGGAATTGCGTAAAG - UNI6537 - GGATGAATACACTTGTTGGCTATGATCTGGTTCCTGAG

CCCAAAATCATTGATGCTGCATTGCGAGCATGTAGACGGTTAAATGATTTTGCTAGTGCTGTTCGCATCTTGGAGGTTGTTAAG - UNI26458 - GA

CAAAGCAGGACCTCATAAGGAAATCTATCCCTATGTCATCCAGGAACTTAGACCAACTTTAAATGAATTGGGAATCTCCACTCCAGAGGAGCTGGGCCTT

GACAAAGTGTAAACTCCCTTCG - UNI25410 - ATGGGCTTCCTAAGGACTTAACTGCTATTGCTACTTGATTGAAACAGTTGCCTGGAAATGTTTT

ATTTGAACAAATTTTCCTTTGAGTATCAAACCATGTAATAGTAACTTGGACTTTAATAAAGGGAAATGAGTTTGAACT
Translation
MLAAALRRCTAAAAARGLLHPASAPSPAAA - UNI12427 - AVCSIRCYSHGSHETDEEFDARWVTYFNKPDIDAWELRKG - UNI6537 - GMN

TLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVK - UNI26458 - DKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV - UNI25410

 - 

For any suggestions or comments, please send an email to unitrap@crg.es