Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000197 (Nalcn)
Chromosomal location
Chr 14: 123675863 - 124026366 (-)
Description
sodium leak channel, non-selective Gene [Source:MGI Symbol;Acc:MGI:2444306]
Human Ortholog
not available
Omim not available
UniTrap UNI37978
Vector Insertion
Chr 14: 123808917 - 123859651
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000072254
Sequence
GAGAGAGGGAAGCCACCTGCAAGTACGGACCCTGGCACTGGCCACCAGCTGCGGCGGCGCTGCCTTGAGCATCCTCCGTAGCTCGCGCAGCAAAGCCAAC

AGCAAAAGGCAAGCGAATAAACGCAAGGCCAGGACTCCTGCAGCTCTCTCCGTGCCCCTCGCTCGTGCGGCAGATGCTAGTGCAGAACCAGCACGGAGCT

GACTGAGCCGCCATAGGTGAGGGGCCGCGTCCCCACCCGCTCAGGCCGGCGCGCCCCGCACGGATCCCGCTTGCCGCCGCCGCCGCTGCAGCCTCAGCAC

CATGACTACTCCGCGCGCTGCGGTTACAG ACTGTGGTTTTGTACCTGCCTCCCAAAGCTAACTTCAGCATGCTCAAAAGAAAGCAGAGTTCCAGGGTGG

AAGCCCAGCCAGTTACTGACTTTGGTCCTGATGAATCTCTGTCAGACAATGCTGACATACTCTGGATTAATAAGCCA TGGGTGCACTCTCTGCTGCGCA

TCTGTGCCATCATCAGCGTCATCTCAGTGTGCATGAACACACCTATGACCTTTGAGCACTATCCTCCTCTTCAGTATGTGACCTTCACCTTGGACACTTT

ATTGATGTTCCTCTACACTGCAGAAATGATAGCAAAGATGCACATACGGGGAATTGTCAAG GGTGATAGCTCCTATGTGAAGGATCGCTGGTGTGTTTT

TGATGGATTCATGGTCTTTTGCCTTTGGGTATCTCTTGTGTTACAG GTGTTTGAAATAGCTGACATAGTTGATCAGATGTCACCTTGGGGCATGCTGCG

GATCCCACGGCCACTCATTATGATCCGGGCTTTCAGGATTTATTTCCGATTCGAACTGCCAAGGACAAGAATTACAAACATTTTAAA GCGGTCAGGAGA

ACAAATATGGAGTGTTTCCATTTTCCTCCTTTTCTTCCTTCTTCTGTATGGGATTTTAGGAGTTCAAATGTTTGGAACATTTACCTACCACTGTGTAGTC

AATGACACAAAGCCAGG AAATGTAACCTGGAATAGCTTAGCTATTCCAGATACGCACTGCTCCCCAGAGCTAGAAGAAGGCTATCAATGCCCGCCAGGA

TTTAAATGCATGGACCTGGAAGACCTGGGACTTAGCAGGCAAGAGCTGGGCTACAGTGGCTTTAATGAGATAG GCACGAGTATATTCACAGTCTATGAG

GCTTCATCTCAGGAAGGCTGGGTATTCCTCATGTACAGAGCAATCGACAGCTTTCCCCGCTGGCGCTCCTACTTCTACTTCATCACACTGATTTTCTTCC

TTGCTTGGCTTGTCAAG AATGTGTTTATTGCTGTCATCATTGAGACATTTGCAGAAATCAGAGTACAATTTCAACAAATGTGGGGAACTCGGAGCAGCA

CAACTTCTACAGCCACCACACAG ATGTTCCATGAAGATGCCGCTGGTGGTTGGCAGCTGGTAGCTGTGGATGTCAACAAGCCCCAGGGACGTGCCCCAG

CCTGCCTACAG AAAATGATGCGGTCATCGGTTTTCCACATGTTTATCCTGAGCATGGTGACTGTGGATGTAATAGTTGCTGCCAGCAATTACTACAAGG

GAGAGAACTTCAGAAGGCAGTATGATGAATTCTACCTTGCAGAG - UNI37978 - GTTCTGCGGGTAGTCCGGCTTATTAAGATTTCCCCAGCATTG

GAAGACTTTGTGTACAAGATATTTGGTCCTGGGAAAAAACTTGGAAGCTTGGTGGTGTTCACTGCCAGCCTCCTGATAGTTATGTCAGCCATCAGTTTGC

AGATGTTCTGTTTTGTCGAAGAACTGGACAGATTCACCACTTTTCCAAGG - UNI37978 - GCATTTATGTCTATGTTCCAGATCCTCACCCAGGAA

GGATGGGTGGATGTGATGGATCAGACTCTGAATGCTGTGGGGCATATGTGGGCACCACTGGTTGCCATCTATTTCATCCTCTATCATCTCTTTGCAACTT

TG - UNI37978 - ATCCTCCTGAGTTTGTTTGTTGCTGTTATTTTGGACAACTTAGAACTTGATGAAGATCTAAAGAAGCTCAAACAA CTAAAGCA

AAGTGAAGCGAACGCGGACACCAAAGAAAAACTCCCTTTGCGCTTGAGAATCTTCGAAAAATTTCCAAACAGACCGCAAATGGTGAAAATCTCAAAACTT

CCTTCAGATTTTACAGTTCCTAAAATCAG GGAAAGCTTCATGAAGCAGTTCATTGACCGCCAGCAACAGGACACCTGCTGTCTCTTCAGAATCCTCCCC

TCTACCTCTTCCTCATCATGTGACAACCCCAAGAAGCCCACAGCTGAAGACAACAAATACATTGATCAAAAA CTCCGCAAGTCTGTTTTCAGCATAAGG

GCGAGGAACCTACTGGAAAAGGAGACTGCAGTCACAAAAATCTTAAG AGCTTGCACTCGACAGCGCATGCTGAGCGGATCATTCGAGGGGCAGCCAGCA

AAGGAGAGGTCGATCCTCAGCGTGCAGCATCACATCCGCCAGGAGCGCAG GTCACTAAGACATGGATCCAACAGCCAGAGGATCAGCAGGGGGAAATCT

CTTGAAACTTTAACTCAAGAC CATTCAAATACAGTGCGCTACAGAAATGCACAAAGAGAAGACAGTGAAATAAAAATGATTCAGGAGAAGAAGGAACAA

GCCGAGATGAAAAG GAAGGTGCAAGAAGAGGAACTGCGGGAGAACCACCCATACTTTGACAAGCCTCTCTTCATCGTGGGGCGGGAGCACAGGTTCAGA

AACTTCTGCCGCGTGGTGGTTCGAGCACGCTTCAATGC ATCCAAAACAGACCCTGTCACGGGAGCTGTGAAAAATACAAAGTACCACCAACTTTA TGA

TTTGCTGGGACTTGTCACCTACCTGGACTGGGTCATGATCACTGTAACCATCTGCTCTTGCATTTCTATGATGTTCGAATCCCCCTTCCGAAGAGTCATG

CATGCACCCACTTTACAG ATCGCAGAATATGTGTTTGTAATATTCATGAGCATTGAGCTTAATCTGAAGATTATGGCAGATGGCTTGTTTTTCACTCCA

ACTGCTGTCATCAGGGACTTTGGTGGCGTCATGGACATATTTATCTATCTT GTCTCCATTCTGTTGTTGACGTTAATGCTTGTTTTTGCAAGCTTTGGG

GTTCAGCTCTTTGCTGGAAAGTTAGCCAAGTGCAACGACCCCAACATTATCAGAAGG GAAGACTGTAATGGCATCTTCAGAATTAATGTAAGTGTGTCC

AAGAACTTAAATTTAAAACTAAGACCTGGAGAGAAAAAACCTGGATTTTGGGTGCCCCGTGTTTG GGCAAATCCTCGGAACTTTAACTTCGACAATGTG

GGAAATGCCATGCTGGCATTATTTGAAGTTCTGTCCTTGAAAGGCTGGGTAGAAGTGAGGGATGTCATTATTCATCGTGTGGGGCCG ATCCACGGAATC

TATATTCATGTTTTCGTATTCCTGGGTTGCATGATCGGACTGACGCTTTTTGTCGGTGTAGTTATTGCTAACTTCAATGAAAACAAG GGGACAGCCCTG

CTGACGGTAGATCAGAGACGATGGGAAGATCTCAAGAGCAGACTGAAGATCGCACAGCCTCTTCATCTCCCTCCTCGGCCGG ATATATGAGGGAAATGT

ACTAAGCTCCCAGAAATCGAATGATGAGATTCTCCTTTCAATACGGATGGTGCTATGTGCTGTCGTTTTGATATCCAGCACCAGCCATTCCTCCAAAGCA

CTTCACAATAGATTAAACTGGAAGGGAAGGCTGTAATGGGCTTGAAGATGAACATTAAAGAATGTGAAAG
Translation
 MLKRKQSSRVEAQPVTDFGPDESLSDNADILWINKP WVHSLLRICAIISVISVCMNTPMTFEHYPPLQYVTFTLDTLLMFLYTAEMIAKMHIRGIVK 

GDSSYVKDRWCVFDGFMVFCLWVSLVLQ VFEIADIVDQMSPWGMLRIPRPLIMIRAFRIYFRFELPRTRITNILK KRSGEQIWSVSIFLLFFLLLYGI

LGVQMFGTFTYHCVVNDTKPG GNVTWNSLAIPDTHCSPELEEGYQCPPGFKCMDLEDLGLSRQELGYSGFNEIG GTSIFTVYEASSQEGWVFLMYRAI

DSFPRWRSYFYFITLIFFLAWLVK NVFIAVIIETFAEIRVQFQQMWGTRSSTTSTATTQ MFHEDAAGGWQLVAVDVNKPQGRAPACLQ KMMRSSVFH

MFILSMVTVDVIVAASNYYKGENFRRQYDEFYLAE - UNI37978 - VLRVVRLIKISPALEDFVYKIFGPGKKLGSLVVFTASLLIVMSAISLQMFC

FVEELDRFTTFPR - UNI37978 - AFMSMFQILTQEGWVDVMDQTLNAVGHMWAPLVAIYFILYHLFATL - UNI37978 - ILLSLFVAVILDN

LELDEDLKKLKQ LKQSEANADTKEKLPLRLRIFEKFPNRPQMVKISKLPSDFTVPKIR RESFMKQFIDRQQQDTCCLFRILPSTSSSSCDNPKKPTAE

DNKYIDQK LRKSVFSIRARNLLEKETAVTKILR RACTRQRMLSGSFEGQPAKERSILSVQHHIRQERR RSLRHGSNSQRISRGKSLETLTQD HSNT

VRYRNAQREDSEIKMIQEKKEQAEMKR RKVQEEELRENHPYFDKPLFIVGREHRFRNFCRVVVRARFNA ASKTDPVTGAVKNTKYHQLY YDLLGLVT

YLDWVMITVTICSCISMMFESPFRRVMHAPTLQ IAEYVFVIFMSIELNLKIMADGLFFTPTAVIRDFGGVMDIFIYL VSILLLTLMLVFASFGVQLFA

GKLAKCNDPNIIRR EDCNGIFRINVSVSKNLNLKLRPGEKKPGFWVPRVW WANPRNFNFDNVGNAMLALFEVLSLKGWVEVRDVIIHRVGP IHGIYI

HVFVFLGCMIGLTLFVGVVIANFNENK GTALLTVDQRRWEDLKSRLKIAQPLHLPPRPD DI
Transcript ENSMUST00000000201
Sequence
GAGAGAGGGAAGCCACCTGCAAGTACGGACCCTGGCACTGGCCACCAGCTGCGGCGGCGCTGCCTTGAGCATCCTCCGTAGCTCGCGCAGCAAAGCCAAC

AGCAAAAGGCAAGCGAATAAACGCAAGGCCAGGACTCCTGCAGCTCTCTCCGTGCCCCTCGCTCGTGCGGCAGATGCTAGTGCAGAACCAGCACGGAGCT

GACTGAGCCGCCATAGGTGAGGGGCCGCGTCCCCACCCGCTCAGGCCGGCGCGCCCCGCACGGATCCCGCTTGCCGCCGCCGCCGCTGCAGCCTCAGCAC

CATGACTACTCCGCGCGCTGCGGTTACAG ACTGTGGTTTTGTACCTGCCTCCCAAAGCTAACTTCAGCATGCTCAAAAGAAAGCAGAGTTCCAGGGTGG

AAGCCCAGCCAGTTACTGACTTTGGTCCTGATGAATCTCTGTCAGACAATGCTGACATACTCTGGATTAATAAGCCA TGGGTGCACTCTCTGCTGCGCA

TCTGTGCCATCATCAGCGTCATCTCAGTGTGCATGAACACACCTATGACCTTTGAGCACTATCCTCCTCTTCAGTATGTGACCTTCACCTTGGACACTTT

ATTGATGTTCCTCTACACTGCAGAAATGATAGCAAAGATGCACATACGGGGAATTGTCAAG GGTGATAGCTCCTATGTGAAGGATCGCTGGTGTGTTTT

TGATGGATTCATGGTCTTTTGCCTTTGGGTATCTCTTGTGTTACAG GTGTTTGAAATAGCTGACATAGTTGATCAGATGTCACCTTGGGGCATGCTGCG

GATCCCACGGCCACTCATTATGATCCGGGCTTTCAGGATTTATTTCCGATTCGAACTGCCAAGGACAAGAATTACAAACATTTTAAA GCGGTCAGGAGA

ACAAATATGGAGTGTTTCCATTTTCCTCCTTTTCTTCCTTCTTCTGTATGGGATTTTAGGAGTTCAAATGTTTGGAACATTTACCTACCACTGTGTAGTC

AATGACACAAAGCCAGG AAATGTAACCTGGAATAGCTTAGCTATTCCAGATACGCACTGCTCCCCAGAGCTAGAAGAAGGCTATCAATGCCCGCCAGGA

TTTAAATGCATGGACCTGGAAGACCTGGGACTTAGCAGGCAAGAGCTGGGCTACAGTGGCTTTAATGAGATAG GCACGAGTATATTCACAGTCTATGAG

GCTTCATCTCAGGAAGGCTGGGTATTCCTCATGTACAGAGCAATCGACAGCTTTCCCCGCTGGCGCTCCTACTTCTACTTCATCACACTGATTTTCTTCC

TTGCTTGGCTTGTCAAG AATGTGTTTATTGCTGTCATCATTGAGACATTTGCAGAAATCAGAGTACAATTTCAACAAATGTGGGGAACTCGGAGCAGCA

CAACTTCTACAGCCACCACACAG ATGTTCCATGAAGATGCCGCTGGTGGTTGGCAGCTGGTAGCTGTGGATGTCAACAAGCCCCAGGGACGTGCCCCAG

CCTGCCTACAG AAAATGATGCGGTCATCGGTTTTCCACATGTTTATCCTGAGCATGGTGACTGTGGATGTAATAGTTGCTGCCAGCAATTACTACAAGG

GAGAGAACTTCAGAAGGCAGTATGATGAATTCTACCTTGCAGAG GTGGCTTTTACAGTCCTTTTCGACCTGGAAGCACTCCTGAAGATATGGTGTTTGG

GGTTTACTGGCTACATCAGCTCATCTCTCCACAAGTTTGAACTATTGCTTGTTATTGGGACGACGCTTCATGTGTACCCAGATCTTTATCATTCTCAGTT

CACATACTTCCAG - UNI37978 - GTTCTGCGGGTAGTCCGGCTTATTAAGATTTCCCCAGCATTGGAAGACTTTGTGTACAAGATATTTGGTCCTG

GGAAAAAACTTGGAAGCTTGGTGGTGTTCACTGCCAGCCTCCTGATAGTTATGTCAGCCATCAGTTTGCAGATGTTCTGTTTTGTCGAAGAACTGGACAG

ATTCACCACTTTTCCAAGG - UNI37978 - GCATTTATGTCTATGTTCCAGATCCTCACCCAGGAAGGATGGGTGGATGTGATGGATCAGACTCTGA

ATGCTGTGGGGCATATGTGGGCACCACTGGTTGCCATCTATTTCATCCTCTATCATCTCTTTGCAACTTTG - UNI37978 - ATCCTCCTGAGTTTG

TTTGTTGCTGTTATTTTGGACAACTTAGAACTTGATGAAGATCTAAAGAAGCTCAAACAA CTAAAGCAAAGTGAAGCGAACGCGGACACCAAAGAAAAA

CTCCCTTTGCGCTTGAGAATCTTCGAAAAATTTCCAAACAGACCGCAAATGGTGAAAATCTCAAAACTTCCTTCAGATTTTACAGTTCCTAAAATCAG G

GAAAGCTTCATGAAGCAGTTCATTGACCGCCAGCAACAGGACACCTGCTGTCTCTTCAGAATCCTCCCCTCTACCTCTTCCTCATCATGTGACAACCCCA

AGAAGCCCACAGCTGAAGACAACAAATACATTGATCAAAAA CTCCGCAAGTCTGTTTTCAGCATAAGGGCGAGGAACCTACTGGAAAAGGAGACTGCAG

TCACAAAAATCTTAAG AGCTTGCACTCGACAGCGCATGCTGAGCGGATCATTCGAGGGGCAGCCAGCAAAGGAGAGGTCGATCCTCAGCGTGCAGCATC

ACATCCGCCAGGAGCGCAG GTCACTAAGACATGGATCCAACAGCCAGAGGATCAGCAGGGGGAAATCTCTTGAAACTTTAACTCAAGAC CATTCAAAT

ACAGTGCGCTACAGAAATGCACAAAGAGAAGACAGTGAAATAAAAATGATTCAGGAGAAGAAGGAACAAGCCGAGATGAAAAG GAAGGTGCAAGAAGAG

GAACTGCGGGAGAACCACCCATACTTTGACAAGCCTCTCTTCATCGTGGGGCGGGAGCACAGGTTCAGAAACTTCTGCCGCGTGGTGGTTCGAGCACGCT

TCAATGC ATCCAAAACAGACCCTGTCACGGGAGCTGTGAAAAATACAAAGTACCACCAACTTTA TGATTTGCTGGGACTTGTCACCTACCTGGACTGG

GTCATGATCACTGTAACCATCTGCTCTTGCATTTCTATGATGTTCGAATCCCCCTTCCGAAGAGTCATGCATGCACCCACTTTACAG ATCGCAGAATAT

GTGTTTGTAATATTCATGAGCATTGAGCTTAATCTGAAGATTATGGCAGATGGCTTGTTTTTCACTCCAACTGCTGTCATCAGGGACTTTGGTGGCGTCA

TGGACATATTTATCTATCTT GTGAGTTTGATATTTCTTTGTTGGATGCCTCAAAATGTACCTGCCGAGTCAGGAGCCCAGCTACTGATGGTTCTTCGGT

GCCTAAGACCTCTTCGGATATTCAAACTTGTGCCCCAAATGAGGAAAGTTGTTCGAGAACTTTTCAGTGGTTTCAAGGAAATATTTTTG GTCTCCATTC

TGTTGTTGACGTTAATGCTTGTTTTTGCAAGCTTTGGGGTTCAGCTCTTTGCTGGAAAGTTAGCCAAGTGCAACGACCCCAACATTATCAGAAGG GAAG

ACTGTAATGGCATCTTCAGAATTAATGTAAGTGTGTCCAAGAACTTAAATTTAAAACTAAGACCTGGAGAGAAAAAACCTGGATTTTGGGTGCCCCGTGT

TTG GGCAAATCCTCGGAACTTTAACTTCGACAATGTGGGAAATGCCATGCTGGCATTATTTGAAGTTCTGTCCTTGAAAGGCTGGGTAGAAGTGAGGGA

TGTCATTATTCATCGTGTGGGGCCG ATCCACGGAATCTATATTCATGTTTTCGTATTCCTGGGTTGCATGATCGGACTGACGCTTTTTGTCGGTGTAGT

TATTGCTAACTTCAATGAAAACAAG GGGACAGCCCTGCTGACGGTAGATCAGAGACGATGGGAAGATCTCAAGAGCAGACTGAAGATCGCACAGCCTCT

TCATCTCCCTCCTCGGCCGG ATAATGATGGTTTTAGAGCTAAAATGTATGACATAACCCAGCATCCATTTTTTAAGAGGACAATTGCATTGCTGGTTCT

GGCCCAGTCTGTGTTGCTATCTGTCAAG TGGGATGTTGACGATCCTGTGACGGTTCCTTTGGCAACAATGTCAGTTGTCTTCACCTTCATCTTTGTCTT

AGAG GTTACAATGAAGATTATAGCAATGTCACCAGCTGGATTCTGGCAAAGCAGAAGAAACCGATATGATCTCTTGGTGACATCTCTTGGTGTTGTGTG

GGTGGTGCTCCATTTTGCTCTGCTG AATGCATACACCTACATGATGGGAGCCTGCGTGATTGTCTTTAGATTTTTCTCCATCTGTGGGAAGCAT GTGA

CATTAAAGATGCTCCTTCTGACTGTGGTTGTCAGCATGTACAAGAGCTTTTTTATCATCGTAGGAATGTTTCTCTTGCTGCTGTGCTATGCCTTTGCTGG

AGTTGTTCTGTTTGGTACCGTAAAGTATGGTGAGAACATTAACAG GCATGCCAATTTTTCCTCAGCTGGCAAAGCCATTACTGTATTGTTTCGAATTGT

CACAGGTGAAGACTGGAACAAGATTATGCATGATTGTATG GTTCAACCTCCATTTTGTACTCCAGATGAATTTACATACTGGGCAACAGACTGTGGCAA

TTATGCAGGGGCACTTATGTACTTCTGCTCATTCTATGTCATCATTGCCTACATCATGCTGAATCTGCTTGTAG CCATAATTGTGGAGAATTTCTCTTT

GTTTTATTCCACTGAAGAGGACCAGCTTTTGAGTTACAATGATCTTCGCCATTTTCAAATCATATGGAACATGGTAGATGATAAAAGAGAG GGTGTGAT

CCCCACTTTCCGAGTGAAGTTCCTGCTACGGCTGCTGCGTGGGAGGCTGGAAGTGGATCTTGATAAAGACAAGCTCCTGTTTAAGCATATGTGCTATGAG

ATGGAGAGGCTGCACAATGGTGGTGATGTCACCTTCCATGATGTCTTAAG CATGCTCTCCTATCGCTCTGTAGACATCAGAAAAAGCCTGCAGCTAGAG

GAGCTGCTGGCAAGGGAGCAGCTAGAATACACCATAGAGGAGGAGGTGGCTAAGCAGACTATTCGCATGTGGCTGAAGAAGTGCTTGAAACGCATCCGGG

CT AAACAACAGCAGTCGTGCAGCATCATCCACAGCCTGAGAGAGAGCCAGGAGCAAGAGCGGAGCCGGCTATTCCTGAATCCTCCCAGCATTGAGACCA

CCCAGCCAAGTGAGGACAGCAACGCCAACAGCCAGGACCACAGTATGCAACCTGAG ACAAGCAGTCAGCAGCAGCTCTTAAGCCCTACTCTGTCAGACA

GAGGAGGAAGCCGACAGGATGCAGCAGATACTGGAAAACCCCAAAGGAAGATTGGGCAATGGCGTCTGCCCTCAG CCCCCAAACCAATAAGCCATTCTG

TATCTTCGGTTAACCTACGGTTTGGAGGAAGGACAACGATGAAGACTGTGGTGTGCAAGATGAACCCCATGCCAGACACAGCTTCCTGTGGCTCTGAAGT

TAAAAAGTGGTGGACCAGACAGCTGACCGTGGAGAGTGACGAGAGTGGAGATGACCTCCTGGATATTTAGATGGGAAGCAAGGCATAGGGAGTCCTAGGG

TGAAAACTATAGCTAATAGTTTCTTTCATCATTGGGAGAGAGCAAACTGTAATTGCTAAACCCTAAATTCCACCCAAGCATGGGTTTTTCAGAATTGATT

TTTGTTCATTTGTTGGAATGGTCTCTCAGAGTATGTTTTGGATTATTGTCATGTATTAAAAAAATGTGGGGCTTGGGAGATAAGTCAGTGAAAGACCTCT

TGCTCAACCTGTGCCAACCCCTATGTTTGAATCCCAGAAATACAAGGAAAGAAAGAAAATATGTATAAAGCAGTATTGATAATATTAGAAGCTGCATCAA

CAGTAGAGTATATTATATATTCATGTATTCTGTCTGTGTAAACTAAGCTGTATTCATCTGCACTCTCATATGTTATTACTACCCCTCTCAAAGAGTGCTG

AGCCCAAACTGGTCCATATTTATAGTACAGGAGTTATAGCTATAGTTCACTTTTTTCCCCATTTCCAATAGAAATACTTCCCTTGGGAGAAATTATTTAT

GATTGATCTGAAAAGGTCAGTACTGTGCTTGTGCTAAAATGATAGCAGCTTCAAAACTATAGATTCTGAAGTTTTTAAAAGCATATTCTTTTTCTTTGTG

TTATTTTTTTAAAAAATGCTTAATGTTAAAAAAAATCAGGCCCGTTTTATTTCTGTTTTCAAGTACTCCAATAAAATTGTTGCCTGCTTCTGAGAAAGTT

ATGTGTGTAGGTACCATGTAAAGGATTTGGCTACAGATGTATTGGTATATAACATACTTGTAGGTGTATTACTTCATGAACTTGATGAGACGAAAATGTC

TTGAAACCTTTAAAAATTCTTTAAACAACTCAGTTTAGAAAACAGAATAGACGTGTTAGGGTCAACTTGGCTAAAAGTTTACACTTGAGAGATTATTGTG

GACTTCATGACTTGTCCTTGCTGTAGCCATTTTGCTATGAATGAACAGGAACATTATGGGTTGGCTTTAATACACCGTTTCTATGCTAGATTCAAAATAA

TTTCCCTGCTCCCAGGATTAACTATTGAAATAACAGAAGGGTGCAAAAACCTCACTCTAAACCCCATTGGAAATACCACAATGTAATTGTATATTTTCCC

ACATGCCAATGGTCCATGTCCTCTGGGAAAAAGTGGATATACAATACTATTGGAAAGCACTGATGGACCCTGGCTGGGGAGGGTCTCCCTTGAGTTATCA

ATTTCATATCTGATAATCAGATTATTTTAAGAGATTGAGTGTGTAAAAATTCCCTGATGCCTAGGTTGCTTTATGATATCCTTTTCTCTATTTAACCTTG

CTTAAATAGCCAAACATCACATCCTTCCTACACAGAAGTAATGATGTAATGTGCCCATCTACTGCTTATATGATTACTTGTGACTACTAGACAATAGGCA

ATTCAAGTTTGTGCAGCCAAGGGGAATTTTTATTGGGTTTTATGTTTGTTCAGAATTTGATTTTTGAATATAAAAACAAAATAAAAATCTGATTTGT
Translation
 MLKRKQSSRVEAQPVTDFGPDESLSDNADILWINKP WVHSLLRICAIISVISVCMNTPMTFEHYPPLQYVTFTLDTLLMFLYTAEMIAKMHIRGIVK 

GDSSYVKDRWCVFDGFMVFCLWVSLVLQ VFEIADIVDQMSPWGMLRIPRPLIMIRAFRIYFRFELPRTRITNILK KRSGEQIWSVSIFLLFFLLLYGI

LGVQMFGTFTYHCVVNDTKPG GNVTWNSLAIPDTHCSPELEEGYQCPPGFKCMDLEDLGLSRQELGYSGFNEIG GTSIFTVYEASSQEGWVFLMYRAI

DSFPRWRSYFYFITLIFFLAWLVK NVFIAVIIETFAEIRVQFQQMWGTRSSTTSTATTQ MFHEDAAGGWQLVAVDVNKPQGRAPACLQ KMMRSSVFH

MFILSMVTVDVIVAASNYYKGENFRRQYDEFYLAE VAFTVLFDLEALLKIWCLGFTGYISSSLHKFELLLVIGTTLHVYPDLYHSQFTYFQ - UNI37

978 - VLRVVRLIKISPALEDFVYKIFGPGKKLGSLVVFTASLLIVMSAISLQMFCFVEELDRFTTFPR - UNI37978 - AFMSMFQILTQEGWVD

VMDQTLNAVGHMWAPLVAIYFILYHLFATL - UNI37978 - ILLSLFVAVILDNLELDEDLKKLKQ LKQSEANADTKEKLPLRLRIFEKFPNRPQM

VKISKLPSDFTVPKIR RESFMKQFIDRQQQDTCCLFRILPSTSSSSCDNPKKPTAEDNKYIDQK LRKSVFSIRARNLLEKETAVTKILR RACTRQRM

LSGSFEGQPAKERSILSVQHHIRQERR RSLRHGSNSQRISRGKSLETLTQD HSNTVRYRNAQREDSEIKMIQEKKEQAEMKR RKVQEEELRENHPYF

DKPLFIVGREHRFRNFCRVVVRARFNA ASKTDPVTGAVKNTKYHQLY YDLLGLVTYLDWVMITVTICSCISMMFESPFRRVMHAPTLQ IAEYVFVIF

MSIELNLKIMADGLFFTPTAVIRDFGGVMDIFIYL VSLIFLCWMPQNVPAESGAQLLMVLRCLRPLRIFKLVPQMRKVVRELFSGFKEIFL VSILLLT

LMLVFASFGVQLFAGKLAKCNDPNIIRR EDCNGIFRINVSVSKNLNLKLRPGEKKPGFWVPRVW WANPRNFNFDNVGNAMLALFEVLSLKGWVEVRDV

IIHRVGP IHGIYIHVFVFLGCMIGLTLFVGVVIANFNENK GTALLTVDQRRWEDLKSRLKIAQPLHLPPRPD DNDGFRAKMYDITQHPFFKRTIALL

VLAQSVLLSVK WDVDDPVTVPLATMSVVFTFIFVLE VTMKIIAMSPAGFWQSRRNRYDLLVTSLGVVWVVLHFALL NAYTYMMGACVIVFRFFSICG

KH VTLKMLLLTVVVSMYKSFFIIVGMFLLLLCYAFAGVVLFGTVKYGENINR RHANFSSAGKAITVLFRIVTGEDWNKIMHDCM VQPPFCTPDEFTY

WATDCGNYAGALMYFCSFYVIIAYIMLNLLVA AIIVENFSLFYSTEEDQLLSYNDLRHFQIIWNMVDDKRE GVIPTFRVKFLLRLLRGRLEVDLDKDK

LLFKHMCYEMERLHNGGDVTFHDVLS SMLSYRSVDIRKSLQLEELLAREQLEYTIEEEVAKQTIRMWLKKCLKRIRA KQQQSCSIIHSLRESQEQERS

RLFLNPPSIETTQPSEDSNANSQDHSMQPE TSSQQQLLSPTLSDRGGSRQDAADTGKPQRKIGQWRLPSA APKPISHSVSSVNLRFGGRTTMKTVVCK

MNPMPDTASCGSEVKKWWTRQLTVESDESGDDLLDI

For any suggestions or comments, please send an email to unitrap@crg.es