Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000214 (Th)
Chromosomal location
Chr 7: 150078681 - 150116528 (-)
Description
tyrosine hydroxylase Gene [Source:MGI (curated);Acc:Th-001]
RefSeq_dna
NM_009377 
RefSeq_peptide
NP_033403.1 
UniGene
Mm.1292 
MGI
MGI:98735 
Uniprot/SWISSPROT
P24529 
Uniprot/SPTREMBL
Q3UTB3 Q91ZN2 
Human Ortholog
ENSG00000180176 (TH)
Omim 605407 - SEGAWA SYNDROME, AUTOSOMAL RECESSIVE  
UniTrap UNI32329
Vector Insertion
Chr 7: 150085776 - 150116529
Public Clones IST10371C9 (tigm) IST10498C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105929
Sequence
ATGGCTACAGGTGAACATCTGGTGTCCGAG - UNI32329 - ACATTTGAAGCCAAAATCCACCACTTAGAGACCCGGCCTGCCCAGAGGCCACTGGC

AGGAAGCCCCCACCTGGAGTACTTTGTGCGCTTCGAGGTGCCCAGTGGCGACCTGGCTGCCCTCCTCAGTTCTGTGCGTCGGGTGTCTGACGATGTGCGC

AGTGCCAGAGAGGACAAGG TTCCCTGGTTCCCAAGGAAAGTGTCAGAGTTGGATAAGTGTCACCACCTGGTCACCAAGTTTGACCCTGACCTGGACCTG

GACCATCCG GGCTTCTCTGACCAGGCGTATCGCCAGCGCCGGAAGCTGATTGCAGAGATTGCCTTCCAATACAAGCA GGGTGAGCCAATTCCCCACGT

GGAATACACAAAGGAGGAAATTGCTACCTG GAAGGAGGTATACGCCACGCTGAAGGGCCTCTATGCTACCCATGCCTGCCGGGAACACCTGGAGGCTTT

CCAGCTTCTGGAACGGTACTGTGGCTACCGAGAGGACAGCATTCCACAGCTGGAGGATGTGTCTCACTTCTTGAAGG AACGGACTGGCTTCCAGCTGCG

ACCCGTGGCCGGTCTACTGTCTGCCCGTGATTTTCTGGCCAGTCTGGCCTTCCGTGTGTTTCAGTGCACACAGTACATCCGTCATGCCTCCTCACCTATG

CACTCACCCGAGCC AGACTGCTGCCACGAGCTGCTGGGACACGTACCCATGTTGGCTGACCGCACATTTGCCCAGTTCTCCCAG GACATTGGACTTGC

ATCTCTGGGGGCTTCAGATGAAGAAATTGAAAAACTCTCCACG GTGTACTGGTTCACTGTGGAGTTTGGGCTGTGTAAACAGAATGGGGAGCTGAAGGC

TTACGGTGCAGGGCTGCTGTCTTCCTATGGAGAGCTCCTG CACTCCCTGTCAGAGGAGCCCGAGGTCCGGGCCTTTGACCCAGACACAGCAGCCGTGCA

GCCCTACCAAGATCAAACCTACCAGCCGGTGTACTTCGTGTCAGAGAGCTTCAGTGATGCCAAGGACAAGCTCAG GAACTATGCCTCTCGTATCCAGCG

CCCATTCTCTGTGAAGTTTGACCCGTACACCCTGGCCATTGATGTACTGGACAGTCCTCACACCATCCGGCGCTCCTTAGAGGGGGTCCAGGATGAGCTG

CACACCCTGACCCAAGCACTGAGTGCCATTAGCTAAATGCATAGGGTACCACCCACAGGTGCCAGGGGCCTTTCCCAAAGTTCCCAGCCCCTTCTCCAAC

CTTTCCTGGCCCAGAGGCTTTCCCATGTGTGTGGCTGGACCCTTTGATGGGCTGCTCTTGGTCCCCCTCCTCCACTGCTTCTCAACCACATCTTACTACT

GCATGCGCTCCAGGATGGTCCTGCATTCCTCCTGCCCTTCATGCTGTATTCTACCCTGATTATTATCTCAATAAAGGAAGGAAAGGTCTCC
Translation
MATGEHLVSE - UNI32329 - TFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSAREDKV VPWFPRKVSELDKCHH

LVTKFDPDLDLDHP GFSDQAYRQRRKLIAEIAFQYKQ QGEPIPHVEYTKEEIATW WKEVYATLKGLYATHACREHLEAFQLLERYCGYREDSIPQLE

DVSHFLKE ERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEP PDCCHELLGHVPMLADRTFAQFSQ DIGLASLGASDEEIEKLST

 VYWFTVEFGLCKQNGELKAYGAGLLSSYGELL HSLSEEPEVRAFDPDTAAVQPYQDQTYQPVYFVSESFSDAKDKLR RNYASRIQRPFSVKFDPYTL

AIDVLDSPHTIRRSLEGVQDELHTLTQALSAIS
Transcript ENSMUST00000000219
Sequence
GCACTATGCCCACCCCCAGCGCCTCCTCGCCACAGCCCAAGGGCTTCAGAAGAGCCGTCTCAGAGCAGGATACCAAGCAGGCCGAGGCTGTCACG - UN

I32329 - TCCCCAAGGTTCATTGGACGGCGGCAGAGTCTCATCGAGGATGCCCGCAAGGAGCGGGAGGCAGCAGCAGCTGCAGCAGCGGCTGCGGTAG

CCTCCGCGGAACCTGGGAACCCATTGGAGGCTGTGGTATTCGAGGAGAGGGATGGAAATGCTGTTCTCAACCTGCTCTTCTCCTTGAGGGGTACAAAACC

CTCCTCACTGTCTCGGGCTTTGAAAGTGTTTGAG ACATTTGAAGCCAAAATCCACCACTTAGAGACCCGGCCTGCCCAGAGGCCACTGGCAGGAAGCCC

CCACCTGGAGTACTTTGTGCGCTTCGAGGTGCCCAGTGGCGACCTGGCTGCCCTCCTCAGTTCTGTGCGTCGGGTGTCTGACGATGTGCGCAGTGCCAGA

GAGGACAAGG TTCCCTGGTTCCCAAGGAAAGTGTCAGAGTTGGATAAGTGTCACCACCTGGTCACCAAGTTTGACCCTGACCTGGACCTGGACCATCCG

 GGCTTCTCTGACCAGGCGTATCGCCAGCGCCGGAAGCTGATTGCAGAGATTGCCTTCCAATACAAGCA GGGTGAGCCAATTCCCCACGTGGAATACAC

AAAGGAGGAAATTGCTACCTG GAAGGAGGTATACGCCACGCTGAAGGGCCTCTATGCTACCCATGCCTGCCGGGAACACCTGGAGGCTTTCCAGCTTCT

GGAACGGTACTGTGGCTACCGAGAGGACAGCATTCCACAGCTGGAGGATGTGTCTCACTTCTTGAAGG AACGGACTGGCTTCCAGCTGCGACCCGTGGC

CGGTCTACTGTCTGCCCGTGATTTTCTGGCCAGTCTGGCCTTCCGTGTGTTTCAGTGCACACAGTACATCCGTCATGCCTCCTCACCTATGCACTCACCC

GAGCC AGACTGCTGCCACGAGCTGCTGGGACACGTACCCATGTTGGCTGACCGCACATTTGCCCAGTTCTCCCAG GACATTGGACTTGCATCTCTGGG

GGCTTCAGATGAAGAAATTGAAAAACTCTCCACG GTGTACTGGTTCACTGTGGAGTTTGGGCTGTGTAAACAGAATGGGGAGCTGAAGGCTTACGGTGC

AGGGCTGCTGTCTTCCTATGGAGAGCTCCTG CACTCCCTGTCAGAGGAGCCCGAGGTCCGGGCCTTTGACCCAGACACAGCAGCCGTGCAGCCCTACCA

AGATCAAACCTACCAGCCGGTGTACTTCGTGTCAGAGAGCTTCAGTGATGCCAAGGACAAGCTCAG GAACTATGCCTCTCGTATCCAGCGCCCATTCTC

TGTGAAGTTTGACCCGTACACCCTGGCCATTGATGTACTGGACAGTCCTCACACCATCCGGCGCTCCTTAGAGGGGGTCCAGGATGAGCTGCACACCCTG

ACCCAAGCACTGAGTGCCATTAGCTAAATGCATAGGGTACCACCCACAGGTGCCAGGGGCCTTTCCCAAAGTTCCCAGCCCCTTCTCCAACCTTTCCTGG

CCCAGAGGCTTTCCCATGTGTGTGGCTGGACCCTTTGATGGGCTGCTCTTGGTCCCCCTCCTCCACTGCTTCTCAACCACATCTTACTACTGCATGCGCT

CCAGGATGGTCCTGCATTCCTCCTGCCCTTCATGCTGTATTCTACCCTGATTATTATCTCAATAAAGGAAGGAAAGGTCTCC
Translation
MPTPSASSPQPKGFRRAVSEQDTKQAEAVT - UNI32329 - SPRFIGRRQSLIEDARKEREAAAAAAAAAVASAEPGNPLEAVVFEERDGNAVLNLL

FSLRGTKPSSLSRALKVFE TFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSAREDKV VPWFPRKVSELDKCHHLVTK

FDPDLDLDHP GFSDQAYRQRRKLIAEIAFQYKQ QGEPIPHVEYTKEEIATW WKEVYATLKGLYATHACREHLEAFQLLERYCGYREDSIPQLEDVSH

FLKE ERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEP PDCCHELLGHVPMLADRTFAQFSQ DIGLASLGASDEEIEKLST VYW

FTVEFGLCKQNGELKAYGAGLLSSYGELL HSLSEEPEVRAFDPDTAAVQPYQDQTYQPVYFVSESFSDAKDKLR RNYASRIQRPFSVKFDPYTLAIDV

LDSPHTIRRSLEGVQDELHTLTQALSAIS

For any suggestions or comments, please send an email to unitrap@crg.es