Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000303 (Cdh1)
Chromosomal location
Chr 8: 109127268 - 109194146 (+)
Description
fizzy/cell division cycle 20 related 1 (Drosophila) Gene [Source:MGI (curated);Acc:Cdh1-001]
RefSeq_dna
NM_009864 
RefSeq_peptide
NP_033994.1 
UniGene
Mm.35605 
MGI
MGI:88354 
Uniprot/SWISSPROT
P09803 
Uniprot/SPTREMBL
Q4KML8 
Human Ortholog
ENSG00000039068 (CDH1)
Omim 137215 - GASTRIC CANCER  608089 - ENDOMETRIAL CANCER  
UniTrap UNI10534
Vector Insertion
Chr 8: 109127443 - 109128186
Public Clones G004E07 (ggtc) G057D01 (ggtc) G047D06 (ggtc) G050D04 (ggtc) G038G04 (ggtc)
G037C09 (ggtc) G032D04 (ggtc) G029G03 (ggtc) G082E05 (ggtc) G074F08 (ggtc)
G069A09 (ggtc) G003E01 (ggtc) G079F02 (ggtc) G004F06 (ggtc) G023F06 (ggtc)
G056E12 (ggtc) G003D03 (ggtc) G056B01 (ggtc) G045D09 (ggtc) G055F11 (ggtc)
G038A07 (ggtc) G036G12 (ggtc) G030C06 (ggtc) G025H07 (ggtc) G082B05 (ggtc)
G070H03 (ggtc) G064H08 (ggtc) G051D12 (ggtc) G074G06 (ggtc) G064F08 (ggtc)
D051F04 (ggtc) G082C09 (ggtc) G064D09 (ggtc) G050G10 (ggtc) G047D02 (ggtc)
G064A12 (ggtc) G037G11 (ggtc) G036B02 (ggtc) G030B09 (ggtc) G024A07 (ggtc)
G079B09 (ggtc) G070A02 (ggtc) G014F05 (ggtc) G028C04 (ggtc) G070G04 (ggtc)
G057B06 (ggtc) G004B08 (ggtc) G057D06 (ggtc) G045B01 (ggtc) G050E09 (ggtc)
G038E11 (ggtc) G037A06 (ggtc) G030G11 (ggtc) G029B02 (ggtc) G082E08 (ggtc)
G074A08 (ggtc) G069A11 (ggtc) G003C05 (ggtc) G075D03 (ggtc) G003B04 (ggtc)
G045B07 (ggtc) G050F05 (ggtc) G023H06 (ggtc) G055H09 (ggtc) G045G10 (ggtc)
G057A03 (ggtc) G085B01 (ggtc) G036F08 (ggtc) G030C07 (ggtc) G025G06 (ggtc)
G079E04 (ggtc) G070C02 (ggtc) G020E12 (ggtc) G054G12 (ggtc) G074F04 (ggtc)
G064D08 (ggtc) G074E07 (ggtc) G063H11 (ggtc) G047C11 (ggtc) G050A06 (ggtc)
G038G12 (ggtc) G085A09 (ggtc) G039A03 (ggtc) G030B01 (ggtc) G023G02 (ggtc)
G079B02 (ggtc) G069F02 (ggtc) G003E05 (ggtc) G082B01 (ggtc) G069H03 (ggtc)
G056G12 (ggtc) G003F05 (ggtc) G056H04 (ggtc) G045C07 (ggtc) G055A10 (ggtc)
G085C08 (ggtc) G036G09 (ggtc) G030E07 (ggtc) G030F12 (ggtc) G082D09 (ggtc)
G071A01 (ggtc) G064G08 (ggtc) G047G02 (ggtc) G075C02 (ggtc) G085G01 (ggtc)
G082B03 (ggtc) G045F12 (ggtc) G003C03 (ggtc) G052A05 (ggtc) G047B08 (ggtc)
G057C05 (ggtc) G038B09 (ggtc) G036E11 (ggtc) G030B02 (ggtc) G025B03 (ggtc)
G079D07 (ggtc) G070C07 (ggtc) G016C03 (ggtc) G038H03 (ggtc) G072A04 (ggtc)
G057E06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9027
Vector Insertion
Chr 8: 109128308 - 109172900
Public Clones (sanger) RST102 (baygenomics) PST058 (baygenomics) RST560 (baygenomics)
XST130 (baygenomics) GST159 (baygenomics) RST513 (baygenomics) PST035 (baygenomics)
PST103 (baygenomics) GST193 (baygenomics) GST073 (baygenomics) XK406 (baygenomics)
PST024 (baygenomics) KST259 (baygenomics) RST385 (baygenomics) PST037 (baygenomics)
PST113 (baygenomics) XST071 (baygenomics) GST126 (baygenomics) RST465 (baygenomics)
PST027 (baygenomics) KST281 (baygenomics) P069E03 (ggtc) G085H09 (ggtc)
G070A12 (ggtc) G003D05 (ggtc) E325B08 (ggtc) E325A12 (ggtc) E324D08 (ggtc)
E323G05 (ggtc) D164F10 (ggtc) D139D03 (ggtc) D059F09 (ggtc) G051A11 (ggtc)
G038B12 (ggtc) G029E05 (ggtc) G051G04 (ggtc) E325H01 (ggtc) E324G06 (ggtc)
E323H06 (ggtc) E323B01 (ggtc) D152A09 (ggtc) D099F12 (ggtc) D050D07 (ggtc)
G054C10 (ggtc) G075F04 (ggtc) G054F04 (ggtc) E325B09 (ggtc) E324F04 (ggtc)
E323G11 (ggtc) E323A03 (ggtc) D142A09 (ggtc) D099F01 (ggtc) G057A06 (ggtc)
G039G08 (ggtc) G011B06 (ggtc) G004B10 (ggtc) E325A04 (ggtc) E324A07 (ggtc)
E323F07 (ggtc) D162E04 (ggtc) D124H08 (ggtc) D058E04 (ggtc) G045C12 (ggtc)
G080G02 (ggtc) G069A08 (ggtc) G051F11 (ggtc) E325D04 (ggtc) G057D12 (ggtc)
G075B03 (ggtc) G017F11 (ggtc) D098B09 (ggtc) G051E03 (ggtc) G085G09 (ggtc)
G047D09 (ggtc) G051B06 (ggtc) D160E04 (ggtc) D112H05 (ggtc) G047E02 (ggtc)
G079E08 (ggtc) G056A06 (ggtc) E325C12 (ggtc) E323H04 (ggtc) 5SE325D04 (ggtc)
CMHD-GT_523D5-3 (cmhd) CMHD-GT_460G11-3 (cmhd) CMHD-GT_522F7-5S (cmhd) CMHD-GT_499G9-3 (cmhd)
CMHD-GT_411D3-3 (cmhd) CMHD-GT_430E11-3 (cmhd) CMHD-GT_428B1-3 (cmhd) CMHD-GT_522F7-3 (cmhd)
CMHD-GT_421C10-3 (cmhd) CMHD-GT_320H8-3 (cmhd) CMHD-GT_264G05-3 (cmhd) PST11726-NL (escells)
IST10179C7 (tigm) IST12476B1 (tigm) IST11782A12 (tigm) IST14035C3 (tigm)
IST10181H8 (tigm) IST13899A3 (tigm) IST12511D8 (tigm) IST14753A9 (tigm)
IST14390D3 (tigm) IST14724B5 (tigm) IST14022C7 (tigm) IST13698H3 (tigm)
IST13281A10 (tigm) IST14431C10 (tigm) IST14925A10 (tigm) IST12372A10HMF1 (tigm)
IST14266G5 (tigm) IST14098F9 (tigm) IST12232B12 (tigm) IST10786F6 (tigm)
IST11876H2 (tigm) IST14116H3 (tigm) IST13117E6 (tigm) IST14698B4 (tigm)
IST14181G8 (tigm) IST13928H6 (tigm) IST14099B8 (tigm) IST12330B1 (tigm)
IST10921D11 (tigm) IST14758F2 (tigm) IST11522C8 (tigm) IST14652A12 (tigm)
IST12677D2 (tigm) IST14240D3 (tigm) IST12498H3 (tigm) IST12788F10 (tigm)
IST11020C3 (tigm) IST12276G2 (tigm) IST14706C4 (tigm) IST10374G7 (tigm)
IST13439G9 (tigm) IST14795G11 (tigm) IST14719H4 (tigm) IST13954H10 (tigm)
IST10423H6 (tigm) IST14099B10 (tigm) IST12232C12 (tigm) IST10479G6 (tigm)
IST10892D9 (tigm) IST11446B8 (tigm) IST13334D12 (tigm) IST13762C3 (tigm)
Private Clones OST445171 (lexicon) OST422382 (lexicon) OST420834 (lexicon) OST257927 (lexicon)
OST124988 (lexicon) OST77187 (lexicon) OST43749 (lexicon) OST38921 (lexicon)
OST38564 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13747
Vector Insertion
Chr 8: 109173125 - 109177406
Public Clones CMHD-GT_260F8-3 (cmhd) CMHD-GT_483C12-3 (cmhd)
Private Clones OST332487 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8912
Vector Insertion
Chr 8: 109177820 - 109180723
Public Clones RST538 (baygenomics) RST653 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11518
Vector Insertion
Chr 8: 109183673 - 109184695
Public Clones P071B11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2904
Vector Insertion
Chr 8: 109190231 - 109192305
Public Clones AD0615 (sanger) RRJ666 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000000312
Sequence
ACTGGTGTGGGAGCCGCGGCGCACTACTGAGTTCCCAAGAACTTCTGCTAGACTCCTGCCCGGCCTAACCCGGCCCTGCCCGACCGCACCCGAGCTCAGT

GTTTGCTCGGCGTCTGCCGGGTCCGCCATGGGAGCCCGGTGCCGCAGCTTTTCCGCGCTCCTGCTCCTGCTGCAG - UNI10534 - GTCTCCTCATG

GCTTTGCCAGGAGCTGGAGCCTGAGTCCTGCAGTCCCGGCTTCAGTTCCGAGGTCTACACCTTCCCGGTGCCGGAGAGGCACCTGGAGAGAGGCCATGTC

CTGGGCAGAG - UNI9027 - TGAGATTTGAAGGATGCACTGGCCGGCCAAGGACAGCCTTCTTTTCGGAAGACTCCCGATTCAAAGTGGCGACAGAC

GGCACCATCACAGTGAAGCGGCATCTAAAGCTCCACAAGCTGGAGACCAGTTTCCTCGTCCGCGCCCGGGACTCCAGTCATAGGGAGCTGTCTACCAAAG

TGACGCTGAAGTCCATGGGGCACCACCATCACCGGCACCACCACCGC - UNI13747 - GACCCTGCCTCTGAATCCAACCCAGAGCTGCTCATGTTT

CCCAGCGTGTACCCAGGTCTCAGAAGACAGAAACGAGACTGGGTCATCCCTCCCATCAGCTGCCCCGAAAATGAAAAGGGCGAATTTCCAAAGAACCTGG

TTCAG ATCAAATCCAACAGGGACAAAGAAACAAAGGTTTTCTACAGCATCACCGGCCAAGGAGCTGACAAACCCCCCGTTGGCGTTTTCATCATTGAGA

GGGAGACAGGCTGGCTGAAAGTGACACAGCCTCTGGATAGAGAAGCCATTGCCAAGTACATC - UNI8912 - CTCTATTCTCATGCCGTGTCATCAA

ATGGGGAAGCGGTGGAGGATCCCATGGAGATAGTGATCACAGTGACAGATCAGAATGACAACAGGCCAGAGTTTACCCAGCCGGTCTTTGAGGGATTCGT

TGCAGAAGGCGCTGTTCCAG GAACCTCCGTGATGAAGGTCTCAGCCACCGATGCAGACGATGACGTCAACACCTACAACGCTGCCATCGCCTACACCAT

CGTCAGCCAGGATCCTGAGCTGCCTCACAAAAACATGTTCACTGTCAATAGGGACACCGGGGTCATCAGTGTGCTCACCTCTGGGCTGGACCGAGAG AG

TTACCCTACATACACTCTGGTGGTTCAGGCTGCTGACCTTCAAGGTGAAGGCTTGAGCACAACAGCCAAGGCTGTGATCACTGTCAAGGATATTAATGAC

AACGCTCCTGTCTTCAACCCAAGCACG TATCAGGGTCAAGTGCCTGAGAATGAGGTCAATGCCCGGATCGCCACACTCAAAGTGACCGATGATGATGCC

CCCAACACTCCGGCGTGGAAAGCTGTGTACACCGTAGTCAACGATCCTGACCAGCAGTTCGTTGTTGTCACAGACCCCACGACCAATGATGGCATTTTGA

AAACAGCCAAG - UNI11518 - GGCTTGGATTTTGAGGCCAAGCAGCAATACATCCTTCATGTGAGAGTGGAGAACGAGGAACCCTTTGAGGGGTCT

CTTGTCCCTTCCACAGCCACTGTCACTGTGGACGTGGTAGACGTGAATGAAGCCCCCATCTTTATGCCTGCGGAGAGGAGAGTCGAAGTGCCCGAAGACT

TTGGTGTGGGTCAGGAAATCACATCTTATACCGCTCGAGAGCCGGACACGTTCATGGATCAGAAGATCAC GTATCGGATTTGGAGGGACACTGCCAACT

GGCTGGAGATTAACCCAGAGACTGGTGCCATTTTCACGCGCGCTGAGATGGACAGAGAAGACGCTGAGCATGTGAAGAACAGCACATATGTAGCTCTCAT

CATCGCCACAGATGATG GTTCACCCATTGCCACTGGCACGGGCACTCTTCTCCTGGTCCTGTTAGACGTCAATGACAACGCTCCCATCCCAGAACCTCG

AAACATGCAGTTCTGCCAGAGGAACCCACAGCCTCATATCATCACCATCTTGGATCCAGACCTTCCCCCCAACACGTCCCCCTTTACTGCTGAGCTAACC

CATGGGGCCAGCGTCAACTGGACCATTGAGTATAATGACGCAG CTCAAGAATCTCTCATTTTGCAACCAAGAAAGGACTTAGAGATTGGCGAATACAAA

ATCCATCTCAAGCTCGCGGATAACCAGAACAAAGACCAGGTGACCACGTTGGACGTCCATGTGTGTGACTGTGAAGGGACGGTCAACAACTGCATGAAGG

CGGGAATCGTGGCAGCAGGATTGCAAGTTCCTGCCATCCTCGGAATCCTTGGAGGGATCCTCGCCCTGCTGA TTCTGATCCTGCTGCTCCTACTGTTTC

TACGGAGGAGAACGGTGGTCAAAGAGCCCCTGCTGCCACCAGATGATGATACCCGGGACAATGTGTATTACTATGATGAAGAAGGAGGTGGAGAAGAAGA

CCAG GACTTTGATTTGAGCCAGCTGCACAGGGGCCTGGATGCCCGACCGGAAGTGACTCGAAATGATGTGGCTCCCACCCTCATGAGCGTGCCCCAGTA

TCGTCCCCGTCCTGCCAATCCTGATGAAATTGGAAACTTCATCGATGAA - UNI2904 - AACCTGAAGGCAGCCGACAGCGACCCCACGGCACCCCC

TTACGACTCTCTGTTGGTGTTCGATTACGAGGGCAGTGGTTCTGAAGCCGCTAGCCTGAGCTCACTGAACTCCTCTGAGTCGGATCAGGACCAGGACTAC

GATTATCTGAACGAGTGGGGCAACCGATTCAAGAAGCTGGCGGACATGTACGGCGGTGGTGAGGACGACTAGGGGACTAGCAAGTCTCCCCCGTGTGGCA

CCATGGGAGATGCAGAATAATTATATCAGTGGTCTTTCAGCTCCTTCCCTGAGTGTGTAGAAGAGAGACTGATCTGAGAAGTGTGCAGATTGCATAGTGG

TCTCACTCTCCCTACTGGACTGTCTGTGTTAGGATGGTTTTCACTGATTGTTGAAATCTTTTTTTATTTTTTATTTTTACAGTGCTGAGATATAAACTGT

GCCTTTTTTTGTTTGTTTGTTTCTGTTTTTGTTCTTTTGAGCTATGATCTGCCCCAGACACAACAGCCCCAAGCCCCTCACACCTCACTAATTTTTTACA

TTGTGTACTTGCCCTCAATTACCATGTTTGCTGTATTCTAATAGTCACTCATGTTCCTGAATTCTGTTGCCCTGCCCAGGTGATATTCTAGGATGCAGAA

ATGCCTGGGCCCTTTTATGGTGAGAGACAGGTATCTTGGTGTGGGTGCAACTGCGCTGGATAGTGTGTGTGTTCCCAAGATCTTTCGTGGTATTCCCTCT

CCACCTCCAGAGAACTCATTTACAGTGGCATTCCTTGTTCGGCTATGTGTCTGGGGCAGAACAAAAAAAAGGGACCACTATGCATGCTGCACACGTCTCA

GATTCTTAGGTACACACCTGATTCTTAGGTGCATGCCATAGTGGGATATGTTGCTTTGATCAGAACCTGCAGGGAGGTTTTCGGGCACCACTTAAGTTTC

TTGGCGTTTCTTTCAAACCAAAACTAAAGAATGGTTGTTCTCTGAGAGAGACTGGAGTGCCACCACCAAAGACAGAGGAGAGAAAAGGAGAGAAACCAAA

CTTGGGGACAGCAACATCAGCGAACCCGGCTAGTTGGCACACCGATGGTGAGGGTACACAGGCGGTGAGACCTATCCCACAAGATTTCTGGAAGACTAGG

CTTATCTCAACCAATGTTTTCTGGCTGGAATCTTTGTCCATGTATTCCTGAAGCCCAGGAAATGCACCCCTCCAATGCCTGCTCTTGATGGTAGCTACAG

AAAATGCTGGCCGATTTAAACCCAAGTTGCCCAGTTCTGAGTAGAAAACTGAGACTATGCTGTGTGTGGCGGCGCGCACCTTTAAGCCCAGCACTCAGGA

GGCAGAGGCAGTCAGATCTCCCTGAGTTCGAGGCCAACCTGGTATATATAGTATAGTAAGCGAATTCTAGGACAGCCAGGGCTACACAGAGAAACCCTGT

CTCTGCAAACCAAAAGAGAAAACTGAGAATATTACAAATTGTGCATTTTCTCAGGAAGCAGGAAGAGAACATTCTAACGGGAAAAAGGAGACAAGACCTT

TGAGAGTTTTCATTCAAAATGCAAATCTCAGCTTTTTGATAACCACTGGAAAGAATTTTATTGAAAGTTCTGTACTTACCTAACTTTGGAAGAAAATGAT

GACCACAATCAACTGTGAGAACTGTTGATTTCTCTGTAGTTTAATCATGTAATGTTGCTAGAGTGACCTTTGTATGTAGTTTGAGTGTATGTGTGTGGGT

GCTGATAATTTTGTATTTTGTGGGGGGTGGAAAAGGTAAGCCATTGAAACCGTTCTCTAAGATGCATTTTTATGAATTTTATTAAAGAGTTTTGTTAAAC

TGT
Translation
MGARCRSFSALLLLLQ - UNI10534 - VSSWLCQELEPESCSPGFSSEVYTFPVPERHLERGHVLGRV - UNI9027 - VRFEGCTGRPRTAFFS

EDSRFKVATDGTITVKRHLKLHKLETSFLVRARDSSHRELSTKVTLKSMGHHHHRHHHR - UNI13747 - DPASESNPELLMFPSVYPGLRRQKRDW

VIPPISCPENEKGEFPKNLVQ IKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYI - UNI8912 - LYSHAVSSNGEAV

EDPMEIVITVTDQNDNRPEFTQPVFEGFVAEGAVPG GTSVMKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNRDTGVISVLTSGLDRE SYP

TYTLVVQAADLQGEGLSTTAKAVITVKDINDNAPVFNPST YQGQVPENEVNARIATLKVTDDDAPNTPAWKAVYTVVNDPDQQFVVVTDPTTNDGILKT

AK - UNI11518 - GLDFEAKQQYILHVRVENEEPFEGSLVPSTATVTVDVVDVNEAPIFMPAERRVEVPEDFGVGQEITSYTAREPDTFMDQKIT T

YRIWRDTANWLEINPETGAIFTRAEMDREDAEHVKNSTYVALIIATDDG GSPIATGTGTLLLVLLDVNDNAPIPEPRNMQFCQRNPQPHIITILDPDLP

PNTSPFTAELTHGASVNWTIEYNDAA AQESLILQPRKDLEIGEYKIHLKLADNQNKDQVTTLDVHVCDCEGTVNNCMKAGIVAAGLQVPAILGILGGIL

ALLI ILILLLLLFLRRRTVVKEPLLPPDDDTRDNVYYYDEEGGGEEDQ DFDLSQLHRGLDARPEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDE -

 UNI2904 - NLKAADSDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD

For any suggestions or comments, please send an email to unitrap@crg.es