Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000365 (Rnf17)
Chromosomal location
Chr 14: 57021534 - 57143869 (+)
Description
ring finger protein 17 Gene [Source:MGI Symbol;Acc:MGI:1353419]
RefSeq_dna
NM_001033043 
RefSeq_peptide
NP_001028215.1 
UniGene
Mm.287783 
MGI
MGI:1353419 
Uniprot/SWISSPROT
Q99MV7 
Human Ortholog
ENSG00000132972 (RNF17)
Omim not available
UniTrap UNI34351
Vector Insertion
Chr 14: 57021662 - 57024413
Public Clones IST10383C3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2409
Vector Insertion
Chr 14: 57024509 - 57039911
Public Clones AC0535 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI568
Vector Insertion
Chr 14: 57040004 - 57043294
Public Clones BB0682 (sanger) BB0195 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI296
Vector Insertion
Chr 14: 57060458 - 57078802
Public Clones GC0485 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16327
Vector Insertion
Chr 14: 57099647 - 57100803
Public Clones not available
Private Clones OST463112 (lexicon)
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000095793
Sequence
AGCAATGGCGGCAGAGGCTTCGTCGACCGGGCTGGCTTCCTGTCACCTAGTGGAGAGTAAGAGTGGAGCGCAGGGTGCTTCGGGGTGTCAGTGCACTCGG

TGTGGAAGGAAGGTGTCCGTTGCCTCCG GTGACCACCACAAGTTTCCATGTGGACATGCCTTTTGTGAACTGTGCCTGTTAGCACCTCAAGAATATACC

ACAAGTAAATGCACTGACTGTGAG - UNI2409 - GTTCATACAACTGTCAGCATGAATCAAGGTCACTACCCAGTAGATGGCTTCATCGAGGAAGAT

TCTTCTCTGGAAGCCTTGCCACCGAAAAT - UNI568 - GGTAAATAACTGCTCTTCAGATCTTGAAAAGACAGTGGACCAGCTAATTAATGATTTAG

AACATTCATCCTCCATACATAGGAATGTTTCAAACCCATCAGCTGTAATGTCG GAGACAGAAGAAATTGATGAAGCACTGAAGATAGCAGGCTGTAATT

TTGAACAATTAAGTAATGCTATAAAA ATGCTTGATAGCACACAAGATCAAACAAGACAAGAGACACACAGTCTAACAGAGGCTGTGGAGAAACAGTTTG

ATACACTTCTTGCTTCTCTTGATTCCAG GAAAAAGAGCTTGTGTGAAGAACTTATAAGGCGTACAGATGATTATTTATCAAAATTAGTAACAGTTAAAA

GCTACATTGAAGAGAAAAAAAGTGATTTGGATGCAGCTATGAAGATAGCAAAAGAACTCAGATCTGCTCCTTCTCTGAGGACCTACTGTGACCTGACTCA

G ATTATCCGGACTTTGAAGTTAACATTTGAAAGTGAATTGTCACAAGTTAGTTCCATAATTCCAAGGAACACCCCTAG GTTGGATATAAATTGCAGTG

AGGCCATCTGCATGTTCAGCAGTATGGGAAAGATTGAATTTGAGGACTCAACAAA ATGTTACCCTCAAGAAAATGAAGATGGACAGAATGTTCAAAAGA

AATTTAATAATAGAAAGGAACTCTGTTGTGATGTATACTCATCACTAGAAAAGAAAAAGGTAGATGCTGCTGTCCTGACTGATGAAACACCTGAACCTCC

TTTGCAAGCAGAGGCCCCTGACAGGCATTTAGAAGGGAAAAAGAAGCAGCCAACAAAAGAGATGGTTGTGGTGACATCTCCTAAGACTATTGCTGTACTG

CCTCAACTGGGATCCAGCCCTGATGTGATAATTGAGGAAATTATTGAGGAAAACCTAGAAT CATGCTTTACAGATGATCCTATAGAGACTTCTGGATAC

CCAAAAAAGCCCCCTCAGAAAGAGCAGTCTGCTCCTGTTGGATCAAAAGCAG - UNI296 - GTTGTCCAGAGCTAGTTTTTGTAAGTCATGTAATAC

ATCCTTGCCACTTCTATGTGCGGAAATATTCACAAATAAAAGATGCAACAATATTGGAGAAGAAGATGAAGCAAGTTTGCAATAGGAGCTTACACCTTGA

TCCTTCAGACATTTTGGAACTAG GTGCAAGAATATTTGTCAACAGTATTAAGAATAGAATGTGGTGTCGAGGAATTATCACTGAAATAATTCCATCAAA

AACTAAAAATATTAGAAAACCATGTAGTCCAACCAAATTCTCAGTCTGTGAAATTTCACTAATACAGATATTCATGGTAGATTTTGGAAATTCTGAAGTC

CTGATCATCACAGG AGTTGGTGACACACATGAGGGACCAGAGCATGATGGTGAACAGCATATTACACTAAGTGACTTCTGTCTGCTTCTAATGAAGTCT

GAACCATACAGTGAGGAACTGTTGAAAGACATCCCACATTTAGCACACCTGTGCTCCTTGAAAGACATCGTCCCATACAATTCA ACTGAGGGCTGGGAA

AAGGAGGCAAAAGTGGAATTTTTGAAAATGGTAAATAAGAAGGCTGTCTTAATGAAAGTTTTTGGAGAAGAAGATGATGTCCTTATTGTAGATCTGCAGA

AACCACCAACAAATAAAATCAGCAGTGATATGCCTGTGTCTCTCAGAGATGCATTGGTTTTTATGGAACTAGCAAG GTTTAGGTCACAATCACCAAGAA

GTCACAGTGAAAAAAATACAACTTTATGCTATCATCCACCCATTTTGCCTGAAGAGATGACTGAAGTTTCAGTCATGGTTTGCCATATAAATAGTCCTAC

TGATTTTTATCTTCAGCTG ATGGAGAACCTGGACTTTTTATCTCTTTTAAAAACAATTGAGGAATTCTATAAAGGTGAAGATGGAGAAAATCTGGAAAT

CCTTTGTCCTCTTCAGAATCAAGCCTGTGTAGCTAAATTTGAAGATGGAATCTGGTATCGTGCAAAAGTGATCG GATTGCCTGGACATCGGGAAGTAGA

AGTTAAATATGTGGACTTTGGTAATACTGCAAAAATAACACTTAAAGATATGCGGAAAATAAAGGATGAGTTTTTGGAACCCCCAGAGAAG GCAATTAA

ATGTAAGCTGGCATATGTTGAACCAAGTAAAAAATCACAGTGGTCCAAAAAGGCTAAAGAGAAATTTGAAGAAAAGACTCAAGATAAATTTGTGACATGT

TCTGTTATTA AGATTCTGGAAAATAATGTGCTCTTGGTTGAGCTTTTTGATTCTCGAGCTCCTGGAAAAAGTGCTGTTAGTATTAATGACCAGCTCGTG

AAAGAGGGCCTAGCATCTTATGAAGCAGG - UNI16327 - ATATACCCTCAAAGATAACTCTAAAAAGCATCTTGAAGTATGGGATCCTTCTCCTGA

AGAAATTATTACAAGTGAAATAAACAACTTAAGTCCTTTATCTGTAAAATCTCTACCTAATGAGAATTTCCAGTCATTGTATAACAAGGAGCTGCCTGTG

AACATATGTAATGTAATATCTCCTGAGAAGATTTATGTTCAGTGGTTATTAACAGAAAACTTACTTAATAG TTTAGAAGAGAAGATGGTAGCAGCGTAT

GAGCACTCAGAATGGAAGCCTGTTAAGTGGGAGTGTGATATGCACTGCGCTGTTAAGGTCCCAGCTAAAAATCAGTGGCGAAGAGGCCAGATTCTCAGAA

TGGTTACAGACAAACTGGTAGAG GTCTTGCTTTATGATGTTGGTGTTGAACTAGTAGTGAATATTCACTGCTTAAGAGAACTTCAAGAAAATCTAAAGA

CAATGGGAAGATTATCTTTGGAATGTTCACTTGTTGATATAAG GCCAACTGGCGGAAGTGACAAGTGGACAGCAACAGCTTGTGACTGTCTGTCACTGC

ACCTCACTGGAGCCATAGCAACCATAATCTTACAG GAAAGCAACACAACGTGGCCATTACCTGTGAAAATTTTCTGCCGAGATGAAAAAGGAGAACGTG

TTGATGTTTCTAAATATTTGATTAAAAAAGGTTTGGCATTGAGAGAGAGAAG AGTTAGTAAATCAAGTAACAGCCATTCACCTGAGAAGTCTCTGGAAA

TACCCCTGGAGCAAGGAGATTCAGTAGTTACTAAGTGCTTTAAAATTAACTTTGATACTAACAAGAAAATTGCTGATAAAGTCAATGAACACAAAGTACC

TGATTCTAAGGGAAAGAAATCAGAAAGCAGAAGCACCGGATGCTATAGACCACCAGCTGTTCCTAACACGAGTTCATTTGAGGCAATAGTGACCTGCATT

GGTGACGATGGAACTATATTTGTAGTGCCTAAATTATCAG AATTTGAGCTCATAAAAATGATGGATGAAATTCAAAGTAATTTAAAGTGCCTTGGTCTT

TTGGAGCCATATTCCTGGAAAAAGGGAGAGCCTTGTGCAGTGAGAGGATCTGATACTTTGTGGTACCGTGGCAAAGTTATGGAGGTTGTGGGAGGCACCA

TCAGG GTCCAGTATTTAGATCATGGGTTCACTGAGAAGATTCCACAATGTCATCTGTATCCTATTTTGCTCTATCCTGATACTCCCCAGTTCTGTATTC

CCTGTCAGCTCTATCAGACTTTACCG GTTGGGAATACCTGGCAGCCAGATGCCATAGAGCTGCTTCAGGAGCTGCTTTCAAAGAGAGAGGTGGACATTC

ACATTATG GAATTGCCCAACAATTCATGGGGGAAGTTGTCTGTCCATCTCTATTTTGATGGGATGTCACTTTCTCATTTTATGGCCCATCATAAATACT

GTATTTTTGAACATACCGAGGAGATATTTAAAGAA AAACCAAGAGGTCAGAATAAAAAGTATGAAGATGAAAACTGGAAAATAAGATTTGAG GACTTG

CTTTTGCCTGAAATGGAGGCTCCCGTTTTACCACCGTATCTGTCTTCCCTTCTGCCTCCACCAGAGGAGCTGTTTGCCGTGCAAGTGAAGCACATTGTCT

CACCGGATGAA ATGTATATTTGCCTTGACTCTGAAGATAGCTATACTCAGTTTAACCATCATGGTGACACGGATGACAGTGGAGTCAGCTGGGAGTCAG

AGTCAGAGAACCTGGAGGAAGCGCTGCAGAGATTTAACAAGAACGTGGAGACGTTTCCTCCCCTGACGGATTTTAGCTCAG AGATGCCTTGCCTTGCAG

AATATGCTGATGGTTTGTGGTATAGAGCAAAGATCATTTCCATTAAAGAATTTAACCCTTTATCTGTCCTGGTACTGTTTGTTGATTATGGTTGCACAGA

GAAGTTGACAATAAACAG ACTACGTCAGATTCCTGTTCAGCTTATGCAGTACCCAGCCCAAGCCATAAAGGTGCTCTTGGCAGGGTTTAAACCTCCCTT

AAGTGACTCGGGAAAAACAAGAATACCATACTGTCCCAAATGGAGCATGGAAGCCTTGTGGACTATGATAGACTGTCTCCAAGGAAAACAACTTTATGCT

TCTTCTGTG GCTCAGGCACCAGAACAAATAGTGACATTATATGAAGATGAACAATACCCAGTTCACATGTCCTTGGTAGAAATGGGGCTTGCAGATAAA

GATGAATGAT GTGCACAAGAGCTCCTGCAGCTGTCCAGAAAAAAAGTTTTCTGTTAGATTTGTACCACTTCAGGTTTGATTTTAACTTGTTCTGCAGTG

GTATCAGTTTTTTTCCTCCTTTAGTCTTACTTGGTAAATTGTTAAGGAATGGTGTGGTGAAAAGTTAATATTTTCTTTAAAACGTTTTTGTTTTTACTGT

CCTTTCAAAATAAAATTTAGTCATATAGAAA
Translation
MAAEASSTGLASCHLVESKSGAQGASGCQCTRCGRKVSVASG GDHHKFPCGHAFCELCLLAPQEYTTSKCTDCE - UNI2409 - VHTTVSMNQGHY

PVDGFIEEDSSLEALPPKM - UNI568 - MVNNCSSDLEKTVDQLINDLEHSSSIHRNVSNPSAVMS ETEEIDEALKIAGCNFEQLSNAIK MLDST

QDQTRQETHSLTEAVEKQFDTLLASLDSR RKKSLCEELIRRTDDYLSKLVTVKSYIEEKKSDLDAAMKIAKELRSAPSLRTYCDLTQ IIRTLKLTFES

ELSQVSSIIPRNTPR RLDINCSEAICMFSSMGKIEFEDSTK KCYPQENEDGQNVQKKFNNRKELCCDVYSSLEKKKVDAAVLTDETPEPPLQAEAPDR

HLEGKKKQPTKEMVVVTSPKTIAVLPQLGSSPDVIIEEIIEENLES SCFTDDPIETSGYPKKPPQKEQSAPVGSKAG - UNI296 - GCPELVFVSH

VIHPCHFYVRKYSQIKDATILEKKMKQVCNRSLHLDPSDILELG GARIFVNSIKNRMWCRGIITEIIPSKTKNIRKPCSPTKFSVCEISLIQIFMVDFG

NSEVLIITG GVGDTHEGPEHDGEQHITLSDFCLLLMKSEPYSEELLKDIPHLAHLCSLKDIVPYNS TEGWEKEAKVEFLKMVNKKAVLMKVFGEEDDV

LIVDLQKPPTNKISSDMPVSLRDALVFMELAR RFRSQSPRSHSEKNTTLCYHPPILPEEMTEVSVMVCHINSPTDFYLQL MENLDFLSLLKTIEEFYK

GEDGENLEILCPLQNQACVAKFEDGIWYRAKVIG GLPGHREVEVKYVDFGNTAKITLKDMRKIKDEFLEPPEK AIKCKLAYVEPSKKSQWSKKAKEKF

EEKTQDKFVTCSVIK KILENNVLLVELFDSRAPGKSAVSINDQLVKEGLASYEAG - UNI16327 - GYTLKDNSKKHLEVWDPSPEEIITSEINNL

SPLSVKSLPNENFQSLYNKELPVNICNVISPEKIYVQWLLTENLLNS SLEEKMVAAYEHSEWKPVKWECDMHCAVKVPAKNQWRRGQILRMVTDKLVE 

VLLYDVGVELVVNIHCLRELQENLKTMGRLSLECSLVDIR RPTGGSDKWTATACDCLSLHLTGAIATIILQ ESNTTWPLPVKIFCRDEKGERVDVSKY

LIKKGLALRERR RVSKSSNSHSPEKSLEIPLEQGDSVVTKCFKINFDTNKKIADKVNEHKVPDSKGKKSESRSTGCYRPPAVPNTSSFEAIVTCIGDDG

TIFVVPKLSE EFELIKMMDEIQSNLKCLGLLEPYSWKKGEPCAVRGSDTLWYRGKVMEVVGGTIR VQYLDHGFTEKIPQCHLYPILLYPDTPQFCIPC

QLYQTLP VGNTWQPDAIELLQELLSKREVDIHIM ELPNNSWGKLSVHLYFDGMSLSHFMAHHKYCIFEHTEEIFKE KPRGQNKKYEDENWKIRFE D

LLLPEMEAPVLPPYLSSLLPPPEELFAVQVKHIVSPDE MYICLDSEDSYTQFNHHGDTDDSGVSWESESENLEEALQRFNKNVETFPPLTDFSSE EMP

CLAEYADGLWYRAKIISIKEFNPLSVLVLFVDYGCTEKLTINR RLRQIPVQLMQYPAQAIKVLLAGFKPPLSDSGKTRIPYCPKWSMEALWTMIDCLQG

KQLYASSV AQAPEQIVTLYEDEQYPVHMSLVEMGLADKDE 

For any suggestions or comments, please send an email to unitrap@crg.es