Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000486 (Sept1)
Chromosomal location
Chr 7: 134357964 - 134362012 (-)
Description
septin 1 Gene [Source:MGI (curated);Acc:Sept1-001]
RefSeq_dna
NM_017461 
RefSeq_peptide
NP_059489.2 
UniGene
Mm.18 
MGI
MGI:1858916 
Uniprot/SWISSPROT
P42209 
Uniprot/SPTREMBL
B2RU74 
Human Ortholog
ENSG00000180096 (SEPT1)
Omim not available
UniTrap UNI15868
Vector Insertion
Chr 7: 134361818 - 134361920
Public Clones IST14840E5 (tigm) IST10855A8 (tigm)
Private Clones OST471265 (lexicon) OST295626 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36386
Vector Insertion
Chr 7: 134361484 - 134361746
Public Clones IST10845B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15505
Vector Insertion
Chr 7: 134361132 - 134361572
Public Clones PST6668-NR (escells) IST10442H5HMF1 (tigm) IST10442H6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22897
Vector Insertion
Chr 7: 134360416 - 134360550
Public Clones not available
Private Clones OST281728 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31637
Vector Insertion
Chr 7: 134360416 - 134361257
Public Clones (cmhd) PST19854-NR (escells) IST10442H6 (tigm) IST13079F4 (tigm)
IST10796A1 (tigm) IST12991E6 (tigm) IST10989A1 (tigm) IST10756E4 (tigm)
IST13079H8 (tigm) IST10381H4 (tigm) IST13069F4 (tigm) IST10187D11 (tigm)
IST13754F9 (tigm) IST12009D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36476
Vector Insertion
Chr 7: 134360203 - 134360550
Public Clones IST11781D8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23202
Vector Insertion
Chr 7: 134359484 - 134360203
Public Clones IST10592G10 (tigm) IST12267G5 (tigm) IST14545D1 (tigm) IST11097A3 (tigm)
IST12996G11 (tigm) IST11781F11 (tigm) IST10831G8 (tigm)
Private Clones OST271444 (lexicon)
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30525
Vector Insertion
Chr 7: 134359172 - 134359484
Public Clones IST10945H10 (tigm) IST10922A4HMF1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21731
Vector Insertion
Chr 7: 134358961 - 134359172
Public Clones IST14500H12 (tigm) IST13258D1 (tigm) IST12034D9 (tigm)
Private Clones OST319515 (lexicon)
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25123
Vector Insertion
Chr 7: 134358554 - 134358794
Public Clones IST10035D7 (tigm) IST10241C5 (tigm) IST14870B8 (tigm)
Private Clones OST194518 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23330
Vector Insertion
Chr 7: 134358156 - 134358359
Public Clones not available
Private Clones OST263781 (lexicon) OST211939 (lexicon) OST23632 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25639
Vector Insertion
Chr 7: 134357975 - 134358359
Public Clones not available
Private Clones OST172620 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31547
Vector Insertion
Chr 7: 134357975 - 134358554
Public Clones IST12715B9 (tigm) IST14872A5 (tigm) IST14816C5 (tigm) IST14870B8 (tigm)
IST10241G11 (tigm) IST10241C5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000000497
Sequence
GAAGTGGGGAGCAACACCAGGTGCAAGCGACAACCAGCAGAGCCATG - UNI15868 - GACAAGGAATATGTGGGCTTTGCTGCCCTGCCCAACCAG

CTGCATCGCAAGTCTGTCAAGAAGGGGTTTGACTTCACACTCATGGTGGCAG - UNI15505 - GGGAGTCAGGCCTGGGGAAATCCACCCTCATCAA

CAGCTTGTTCCTCACCAACCTCTACGAGGATCGGCAGGTGCCAGATGCCAGTG - UNI15505 - - UNI31637 - CTCGCACGGCACAAACTCTG

ACCATTGAGCGCCGGGGTGTGGAGATTGAGGAGGGAGGTATCAAGGTGAAGTTGACCTTGGTGGACACGCCTGGCTTTGGGGACTCTGTGGACTGCTCAG

ACTG - UNI15505 - - UNI22897 - - UNI31637 - CTGGCTGCCTGTGGTTCGCTTCATTGAGGAGCAGTTTGAGCAATACCTCAGGGATG

AGAGTGGCTTGAACAGGAAGAACATCCAGGATTCCAGAGTCCATTGCTGCCTCTACTTCATCTCACCCTTTGGCCGA - UNI22897 - - UNI3163

7 - GCTCCGGCCCCTAGATGTGGC TTCCTCCGGGCAGTGCACGAGAAAGTCAATATCATCCCGGTCATCGGTAAAGCAGACGCCCTGATGCCTAGGGA

GACTCAGGCCCTCAAGCAGAAG - UNI23202 - - UNI30525 - ATCCGGGACCAGTTGAAAGAGGAGGAGATCAACATCTATCAGTTCCCAGAG

TGTGACTCTGATGAGGACGAAGAATTCAAGAAGCAGAATGAAGAAATGAAG - UNI30525 - GAAAACATCCCTTTCGCAGTCGTTGGGTCTTGTGA

AGTGGTGAGGGATGGAACCCGACCAGTGAGGGGAAGACGCTACTCCTGGGGTACCGTGGAGG - UNI21731 - - UNI30525 - TGGAGAACCCA

CATCACTGCGATTTCCTGAACCTGAGGCGGATGTTGGTGCAGACCCACCTTCAGGACTTGAAAGAGGTGACCCACGATCTGCTCTACGAGGGCTACCGGG

CTCGCTGCCTACAGAGTCTGGCTCGACCTGGGGCCCGGGATCGAGCCAGCCGCAG - UNI25123 - - UNI31547 - CAAGCTTTCCCGGCAAAG

TGCCACAGAGATCCCGCTGCCCATGTTGCCTCTGGCTGACACTGAAAAGTTGATTCGCGAGAAGGACGAAGAG - UNI23330 - - UNI25639 - 

- UNI31547 - CTGCGCCGCATGCAAGAAATGCTGGAGAAGATGCAAGCCCAGATGCAGCAGAGCCAGGCTCAGGGCGAGCAATCAGATGTGCTGTGA

TATTCCCCAATACCGCCTGTCCTCGCCTCTGCTCACCGCTAATCGGCTATCCCATCCCCGCGCTGGACAGCCCAGCGCCCAATCCGGGGATCCAGAGGGT

AGGCCTGCCCTTGCACTTAAACCAGATCCCTCCAATCCGGAAGTTTAAGGCCCATCCGACTTCGTCTTCCGCGCGGCTCTAAGAGGACCGCACTCCAAGA

AAAGCCTCCCCACCACTCCTCCCCCCCCCCCCCCACCGCTCTTCCCGCGTTCCAATTGGGTTTTCCTATTCCTCCAAGTTCTCCATCTAATAAAAACTGC

TTCCCGCC
Translation
M - UNI15868 - DKEYVGFAALPNQLHRKSVKKGFDFTLMVAG - UNI15505 - GESGLGKSTLINSLFLTNLYEDRQVPDASA - UNI1550

5 - - UNI31637 - ARTAQTLTIERRGVEIEEGGIKVKLTLVDTPGFGDSVDCSDC - UNI15505 - - UNI22897 - - UNI31637 - C

WLPVVRFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGR - UNI22897 - - UNI31637 - APAPRCG FLRAVHEKVNIIPVIGKADAL

MPRETQALKQK - UNI23202 - - UNI30525 - IRDQLKEEEINIYQFPECDSDEDEEFKKQNEEMK - UNI30525 - ENIPFAVVGSCEVV

RDGTRPVRGRRYSWGTVEV - UNI21731 - - UNI30525 - VENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRAS

RS - UNI25123 - - UNI31547 - SKLSRQSATEIPLPMLPLADTEKLIREKDEE - UNI23330 - - UNI25639 - - UNI31547 - 

LRRMQEMLEKMQAQMQQSQAQGEQSDVL
Transcript ENSMUST00000106314
Sequence
CCCCCCCCTTTGTTTGACACCGTTCAACTTCCTGCCCCACCAGAGGAAGTGGGGAGCAACACCAGGTGCAAGCGACAACCAGCAGAGCCATG - UNI15

868 - GACAAGGAATATGTGGGCTTTGCTGCCCTGCCCAACCAGCTGCATCGCAAGTCTGTCAAGAAGGGGTTTGACTTCACACTCATGGTGGCAG - 

UNI15505 - GGGAGTCAGGCCTGGGGAAATCCACCCTCATCAACAGCTTGTTCCTCACCAACCTCTACGAGGATCGGCAGGTGCCAGATGCCAGTG -

 UNI15505 - - UNI31637 - CTCGCACGGCACAAACTCTGACCATTGAGCGCCGGGGTGTGGAGATTGAGGAGGGAGGTATCAAGGTGAAGTTGA

CCTTGGTGGACACGCCTGGCTTTGGGGACTCTGTGGACTGCTCAGACTG - UNI15505 - - UNI22897 - - UNI31637 - CTGGCTGCCTG

TGGTTCGCTTCATTGAGGAGCAGTTTGAGCAATACCTCAGGGATGAGAGTGGCTTGAACAGGAAGAACATCCAGGATTCCAGAGTCCATTGCTGCCTCTA

CTTCATCTCACCCTTTGGCCGAGG GCTCCGGCCCCTAGATGTGGCTTTCCTCCGGGCAGTGCACGAGAAAGTCAATATCATCCCGGTCATCGGTAAAGC

AGACGCCCTGATGCCTAGGGAGACTCAGGCCCTCAAGCAGAAG - UNI23202 - - UNI30525 - ATCCGGGACCAGTTGAAAGAGGAGGAGATC

AACATCTATCAGTTCCCAGAGTGTGACTCTGATGAGGACGAAGAATTCAAGAAGCAGAATGAAGAAATGAAG - UNI30525 - GAAAACATCCCTTT

CGCAGTCGTTGGGTCTTGTGAAGTGGTGAGGGATGGAACCCGACCAGTGAGGGGAAGACGCTACTCCTGGGGTACCGTGGAGG - UNI21731 - - U

NI30525 - TGGAGAACCCACATCACTGCGATTTCCTGAACCTGAGGCGGATGTTGGTGCAGACCCACCTTCAGGACTTGAAAGAGGTGACCCACGATC

TGCTCTACGAGGGCTACCGGGCTCGCTGCCTACAGAGTCTGGCTCGACCTGGGGCCCGGGATCGAGCCAGCCGCAG - UNI25123 - - UNI31547

 - CAAGCTTTCCCGGCAAAGTGCCACAGAGATCCCGCTGCCCATGTTGCCTCTGGCTGACACTGAAAAGTTGATTCGCGAGAAGGACGAAGAG - UNI

23330 - - UNI25639 - - UNI31547 - CTGCGCCGCATGCAAGAAATGCTGGAGAAGATGCAAGCCCAGATGCAGCAGAGCCAGGCTCAGGGC

GAGCAATCAGATGTGCTGTGATATTCCCCAATACCGCCTGTCCTCGCCTCTGCTCACCGCTAATCGGCTATCCCATCCCCGCGCTGGACAGCCCAGCGCC

CAATCCGGGGATCCAGAGGGTAGGCCTGCCCTTGCACTTAAACCAGATCCCTCCAATCCGGAAGTTTAAGGCCCATCCGACTTCGTCTTCCGCGCGGCTC

TAAGAGGACCGCACTCCAAGAAAAGCCTCCCCACCACTCCTCCCCCCCCCCCCCCACCGCTCTTCCCGCGTTCCAATTGGGTTTTCCTATTCCTCCAAGT

TCTCCATCTAATAAAAA
Translation
M - UNI15868 - DKEYVGFAALPNQLHRKSVKKGFDFTLMVAG - UNI15505 - GESGLGKSTLINSLFLTNLYEDRQVPDASA - UNI1550

5 - - UNI31637 - ARTAQTLTIERRGVEIEEGGIKVKLTLVDTPGFGDSVDCSDC - UNI15505 - - UNI22897 - - UNI31637 - C

WLPVVRFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGRG GLRPLDVAFLRAVHEKVNIIPVIGKADALMPRETQALKQK - UNI23202 - 

- UNI30525 - IRDQLKEEEINIYQFPECDSDEDEEFKKQNEEMK - UNI30525 - ENIPFAVVGSCEVVRDGTRPVRGRRYSWGTVEV - UNI

21731 - - UNI30525 - VENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRASRS - UNI25123 - - UNI3154

7 - SKLSRQSATEIPLPMLPLADTEKLIREKDEE - UNI23330 - - UNI25639 - - UNI31547 - LRRMQEMLEKMQAQMQQSQAQGEQS

DVL
Transcript ENSMUST00000106313
Sequence
TGGGCTCAGGTGGTACTGGGGCACTCCCTGCCATGTCCAAGAACCTCATATTGTCTCCCTTTACCCCCACAGGACAAGGAATATGTGGGCTTTGCTGCCC

TGCCCAACCAGCTGCATCGCAAGTCTGTCAAGAAGGGGTTTGACTTCACACTCATGGTGGCAG - UNI15505 - GGGAGTCAGGCCTGGGGAAATCC

ACCCTCATCAACAGCTTGTTCCTCACCAACCTCTACGAGGATCGGCAGGTGCCAGATGCCAGTG - UNI15505 - - UNI31637 - CTCGCACGG

CACAAACTCTGACCATTGAGCGCCGGGGTGTGGAGATTGAGGAGGGAGGTATCAAGGTGAAGTTGACCTTGGTGGACACGCCTGGCTTTGGGGACTCTGT

GGACTGCTCAGACTG - UNI15505 - - UNI22897 - - UNI31637 - CTGGCTGCCTGTGGTTCGCTTCATTGAGGAGCAGTTTGAGCAATA

CCTCAGGGATGAGAGTGGCTTGAACAGGAAGAACATCCAGGATTCCAGAGTCCATTGCTGCCTCTACTTCATCTCACCCTTTGGCCGAGG GCTCCGGCC

CCTAGATGTGGCTTTCCTCCGGGCAGTGCACGAGAAAGTCAATATCATCCCGGTCATCGGTAAAGCAGACGCCCTGATGCCTAGGGAGACTCAGGCCCTC

AAGCAGAAG - UNI23202 - - UNI30525 - ATCCGGGACCAGTTGAAAGAGGAGGAGATCAACATCTATCAGTTCCCAGAGTGTGACTCTGATG

AGGACGAAGAATTCAAGAAGCAGAATGAAGAAATGAAG - UNI30525 - GAAAACATCCCTTTCGCAGTCGTTGGGTCTTGTGAAGTGGTGAGGGAT

GGAACCCGACCAGTGAGGGGAAGACGCTACTCCTGGGGTACCGTGGAGG - UNI21731 - - UNI30525 - TGGAGAACCCACATCACTGCGATT

TCCTGAACCTGAGGCGGATGTTGGTGCAGACCCACCTTCAGGACTTGAAAGAGGTGACCCACGATCTGCTCTACGAGGGCTACCGGGCTCGCTGCCTACA

GAGTCTGGCTCGACCTGGGGCCCGGGATCGAGCCAGCCGCAG - UNI25123 - - UNI31547 - CAAGCTTTCCCGGCAAAGTGCCACAGAGATC

CCGCTGCCCATGTTGCCTCTGGCTGACACTGAAAAGTTGATTCGCGAGAAGGACGAAGAG - UNI23330 - - UNI25639 - - UNI31547 - 

CTGCGCCGCATGCAAGAAATGCTGGAGAAGATGCAAGCCCAGATGCAGCAGAGCCAGGCTCAGGGCGAGCAATCAGATGTGCTGTGATATTCCCCAATAC

CGCCTGTCCTCGCCTCTGCTCACCGCTAATCGGCTATCCCATCCCCGCGCTGGACAGCCCAGCGCCCAATCCGGGGATCCAGAGGGTAGGCCTGCCCTTG

CA
Translation
MVAG - UNI15505 - GESGLGKSTLINSLFLTNLYEDRQVPDASA - UNI15505 - - UNI31637 - ARTAQTLTIERRGVEIEEGGIKVKL

TLVDTPGFGDSVDCSDC - UNI15505 - - UNI22897 - - UNI31637 - CWLPVVRFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPF

GRG GLRPLDVAFLRAVHEKVNIIPVIGKADALMPRETQALKQK - UNI23202 - - UNI30525 - IRDQLKEEEINIYQFPECDSDEDEEFKKQ

NEEMK - UNI30525 - ENIPFAVVGSCEVVRDGTRPVRGRRYSWGTVEV - UNI21731 - - UNI30525 - VENPHHCDFLNLRRMLVQTHL

QDLKEVTHDLLYEGYRARCLQSLARPGARDRASRS - UNI25123 - - UNI31547 - SKLSRQSATEIPLPMLPLADTEKLIREKDEE - UNI2

3330 - - UNI25639 - - UNI31547 - LRRMQEMLEKMQAQMQQSQAQGEQSDVL

For any suggestions or comments, please send an email to unitrap@crg.es