Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000489 (Pdgfb)
Chromosomal location
Chr 15: 79826330 - 79845238 (-)
Description
platelet derived growth factor, B polypeptide Gene [Source:MGI Symbol;Acc:MGI:97528]
RefSeq_dna
NM_011057 
RefSeq_peptide
NP_035187.2 
UniGene
Mm.144089 Mm.409562 
MGI
MGI:97528 
Uniprot/SWISSPROT
P31240 
Uniprot/SPTREMBL
Q549C6 Q8R3X9 
Human Ortholog
ENSG00000100311 (PDGFB)
Omim 607907 - DERMATOFIBROSARCOMA PROTUBERANS  
UniTrap UNI33272
Vector Insertion
Chr 15: 79835898 - 79845239
Public Clones IST13729C11 (tigm) IST14912G9 (tigm) IST14361C6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000000500
Sequence
CTTCGTTGCAACGAGAAAGCCGGAGCAGCCGCAGCTCGAAACCCGCAGAGGAAGCCCAGAGTGGCGAGCGAGTGGGTAGATAGACAGACTGACCCGAGCC

GCGTCCACCTGTCGGCCCGGACCAGCCCAGCGCGCAGTGGGCGCGCCGCGCTCTCGGAGCAGCCGTGCCCGCCGCTTGGGCCCTGCGCCAGGGCGCACAC

GCTCCCGCCCCGCCACCCGGCCCGGGCGGGAGTTTGCACCTCTCCCTGCCCGGGTGTTCGGGCCGCCGCTGCAAAGCCAACTTTGGAAAAAGTTTTTTTT

TGGAGACTTGGGCTTGGAGGTCCCCAGCTCTGCGCTTTCTGATCTGGGGGTCCGTTCCAGAAAATGTTGCAAAAAAGCTAAGCCAGCAGGCAGAGGAACA

CGCCTTTAGCGGGCGAGTGAAGACGAACCATCGGCTGCCGTGTTCCTTTTCCTCTCTGAGGTTGGAGTCCCCTGCGCGCCCCCACACGGCTAGACGCCTT

GGCTGGTTCGCGACGCAGCCCCCAGACTGTGGATGCTCGCGTGGGCTCGGGATCCGCCCAGGTAGCGGCTTTGGACCCCGGTCCCTTGTCCAGGTCCTCC

CCAGCCCCCCAGCGACGGAGCCGGGGCCGGGGGCGGCGGCGCCCGGGGGCCATGCGGGTGAGCCGCGGCGGCGGCTGCAGCGGCCTGATCGCCTGATCGC

GGGGGACCCGAGCGGAGCCCACCCTCCTCCCCAGCCCCCAACCCTGGCCGCGGGGGCGGCGCGCTCCGTCTACGCGTCCGGGGCCCCGCGGGGCCGGGCC

CGGAGTCGGCATGAATCGCTGCTGGGCGCTCTTCCTTCCTCTCTGCTGCTACCTGCGTCTGGTCAGCGCCGAG - UNI33272 - GGGGATCCCATTC

CTGAGGAACTGTATGAAATGCTGAGCGACCACTCCATCCGCTCCTTTGATGATCTTCAGCGCCTGCTGCACAGAGACTCCGTAG - UNI33272 - AT

GAAGATGGGGCTGAGCTGGACTTGAACATGACCCGAGCACACTCCGGAGTCGAGTTGGAAAGCTCATCTCGAGGGAGGAGGAGCCTAG GGTCCCTGGCA

GCAGCAGAGCCTGCTGTAATCGCCGAGTGCAAGACGCGCACAGAGGTGTTCCAGATCTCTCGGAACCTCATCGATCGCACCAACGCCAACTTCCTGGTGT

GGCCGCCCTGTGTGGAGGTGCAGCGCTGCTCCGGCTGCTGCAATAACCGCAATGTGCAATGCCGGGCCTCGCAGGTGCAGATGCGGCCGGTCCAG GTGA

GAAAGATTGAGATTGTGCGAAAGAAGCCCATCTTCAAGAAGGCCACAGTGACCTTGGAGGACCACCTCGCCTGCAAGTGTGAGACAGTAGTGACCCCTCG

GCCTGTGACTAGAAGTCCTGGGACATCCAGGGAGCAGCGAG CCAAGACGCCTCAAGCTCGGGTGACCATTCGGACGGTGAGAATCCGCCGGCCCCCCAA

AGGCAAGCACCGAAAGTTTAAGCACACCCATGACAAGGCGGCCCTGAAGGAGACCCTCGGAGCCTAGGGGCGTCGGCAAGAGTGTGGGCAG GGTTATTT

AATATGGTATTTGCTGTATTGCCCCCATGGGGTCCTTGGAGTGATAATGTTGTTCCCCTCGTCCGTCTGTCTCGATGCCTGATTCGGACGGCCAATGGTG

CTTCCCTCACCCCGTGTGCCCGGCCACCTCCACCAGCAGCGATTCCTCAGCCCGCCCTGCAGCTCCAGATGCAAAGGACTCCACTCCAGGCTGCAGGCTT

CTCTTGACTCCAAGAACCTGGAACAAGTGTGCAGGAGCCTTGCCGGGGGACGTGGACTGTGGACTGGCCCCAGAGCCTGGCACTTAGCCCGAGGACCTCT

GCATGTCCTGCCTGGTTCCTGGACCACTGGCCAGCCAGCAGGGAACATGTTCAGGCAGGCTAGGGTCCCTTGCAGTCCTGTGGCAGGGAGCACAGACTGG

AGGAACTCTGATGGCACCCAGATCTGCCACGCACTCATCTCTTCCTGTCCCCTCAGCCCACAGTGGCTTTTCATTTTATAAGACATGAACTCCTCTGGGC

AGGTGGCCACACACCTTCTCTGATGGATTAGAGGTGCAGTGTGCGTGTGACCTGGGCCGTGTCCCTGCCTCTTTCCACTTCCCCTACGTTCACTTCCGGT

TCATTTCTCTACCTCCACTCTGTGTCTTCTTCCTCATGTGCCCTTCAGTCTGCTCCTCCACGGGGTGTTCGGATCCCGATTGAGGCCCTGAATGCCCGCC

ATTCCTCCCTAGGGCAGGAGACCTGTCTCTTATATTCCACTCCAGCCAAGCAGGGTGAGCAAGGTTGTAATGGGATGTATATTGCACATGATGCACTGCG

TGTGGAGACTGCTGTTCACACCCTAAATATGGCCAACTTGCCTATTATGACGTTCTGGCCAATGTAGGTCAAACCTCTGAGGAAAGGGAACCTTGTTTAA

TTCATACCGAGGCCCTCTGTGGAGTGGCTGTGTGTGCCCTGGCCCAGCCTGAAGCTCAGAATGAGCCCATGGTACTGGGGAAGCAACCCTGTTGTCTGTC

CATTGCCTCCACTTCCTGGGTCTCAGCTGTCCCCTTCCTGACAGGTGAGGGGCACTAGGAGACCTCCAAGGGAGGAACAGCCCTCGCTGCACAGGTGTCC

CTCTGATCTTTTGCGGTTCTACCCGATGGCTCCTTCAAGGAAGCTAGCCAGTAGATTGGAAGTGGGGGAGAGAGGGAGAGCCCTAGAGCCCTTGGGAGGA

CGGATTGACCTGGCCCGCCTCCCTTCCCACACTTTCCCGTCCCCGTTCCTTCTGCTTCCTTCAGTTTGTAAAGTTGGTGATTATATTTTTGGGGGCTTTC

TTTTTATTTTTTAAATGTAAAGTTTATTTATATTCCGTATTTAAAGTTGT
Translation
MNRCWALFLPLCCYLRLVSAE - UNI33272 - GDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVD - UNI33272 - DEDGAELDLNMTRAHSGV

ELESSSRGRRSLG GSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQ VRKIEIVRKKPIFKKA

TVTLEDHLACKCETVVTPRPVTRSPGTSREQRA AKTPQARVTIRTVRIRRPPKGKHRKFKHTHDKAALKETLGA 

For any suggestions or comments, please send an email to unitrap@crg.es