Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000532 (Acvr1b)
Chromosomal location
Chr 15: 101004535 - 101044109 (+)
Description
activin A receptor, type 1B Gene [Source:MGI Symbol;Acc:MGI:1338944]
RefSeq_dna
NM_007395 
RefSeq_peptide
NP_031421.1 
UniGene
Mm.308467 Mm.414401 
MGI
MGI:1338944 
Uniprot/SWISSPROT
Q61271 
Uniprot/SPTREMBL
Q3TZF1 
Human Ortholog
ENSG00000135503 (ACVR1B)
Omim not available
UniTrap UNI17860
Vector Insertion
Chr 15: 101004667 - 101024362
Public Clones (sanger)
Private Clones OST434716 (lexicon) OST109159 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6572
Vector Insertion
Chr 15: 101029446 - 101032408
Public Clones YHB166 (baygenomics) XH676 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10091
Vector Insertion
Chr 15: 101032577 - 101033368
Public Clones XE242 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8601
Vector Insertion
Chr 15: 101035009 - 101039510
Public Clones XE143 (baygenomics) XE208 (baygenomics) XE327 (baygenomics) XD164 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI886
Vector Insertion
Chr 15: 101039642 - 101041167
Public Clones CA0024 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000000544
Sequence
GCGCGCGCGCTGGGCGCTGCTGGGCTGCGGCGGCGGTTACTATGGCGGAGTCGGCCGGAGCCTCCTCCTTCTTCCCCCTTGTTGTCCTCCTGCTCGCCGG

CAGCGGCGGGTCCGGGCCCCGGGGGATCCAGG - UNI17860 - CTCTGCTGTGTGCGTGCACCAGCTGCCTACAGACCAACTACACCTGTGAGACAG

ATGGGGCTTGCATGGTCTCCATCTTTAACCTGGATGGCGTGGAGCACCATGTACGTACCTGCATCCCCAAGGTGGAGCTGGTTCCTGCTGGAAAGCCCTT

CTACTGCCTGAGTTCAGAGGATCTGCGCAACACACACTGCTGCTATATTGACTTCTGCAACAAGATTGACCTCAGGGTCCCCAGCG GACACCTCAAGGA

GCCTGCGCACCCCTCCATGTGGGGCCCTGTGGAGCTGGTCGGCATCATCGCCGGCCCCGTCTTCCTCCTCTTCCTTATCATTATCATCGTCTTCCTGGTC

ATCAACTATCACCAGCGTGTCTACCATAACCGCCAGAGGTTGGACATGGAGGACCCCTCTTGCGAGATGTGTCTCTCCAAAGACAAGACGCTCCAGGATC

TCGTCTACGACCTCTCCACGTCAGGGTCTGGCTCAG GGTTACCCCTTTTTGTCCAGCGCACAGTGGCCCGAACCATTGTTTTACAAGAGATTATCGGCA

AGGGCCGGTTCGGGGAAGTATGGCGTGGTCGCTGGAGGGGTGGTGACGTGGCTGTGAAAATCTTCTCTTCTCGTGAAGAACGGTCTTGGTTCCGTGAAGC

AGAGATCTACCAGACCGTCATGCTGCGCCATGAAAACATCCTTGGCTTTATTGCTGCTGACAATAAAG - UNI6572 - ATAATGGCACCTGGACCCA

GCTGTGGCTTGTCTCTGACTATCACGAGCATGGCTCACTGTTTGATTATCTGAACCGCTACACAGTGACCATTGAGGGAATGATTAAGCTAGCCTTGTCT

GCAGCCAGTGGTTTGGCACACCTGCATATGGAGATTGTGGGCACTCAAG - UNI10091 - GGAAGCCGGGAATTGCTCATCGAGACTTGAAGTCAAA

GAACATCCTGGTGAAAAAAAATGGCATGTGTGCCATTGCAGACCTGGGCCTGGCTGTCCGTCATGATGCGGTCACTGACACCATAGACATTGCTCCAAAT

CAGAGGGTGGGGACCAAACG ATACATGGCTCCTGAAGTCCTTGACGAGACAATCAACATGAAGCACTTTGACTCCTTCAAATGTGCCGACATCTATGCC

CTCGGGCTTGTCTACTGGGAGATTGCACGAAGATGCAATTCTGGAG - UNI8601 - GAGTCCATGAAGACTATCAACTGCCGTATTACGACTTAGTG

CCCTCCGACCCTTCCATTGAGGAGATGCGAAAGGTTGTATGTGACCAGAAGCTACGGCCCAATGTCCCCAACTGGTGGCAGAGTTATGAG - UNI886 

- GCCTTGCGAGTGATGGGAAAGATGATGCGGGAGTGCTGGTACGCCAATGGTGCTGCCCGTCTGACAGCTCTGCGCATCAAGAAGACTCTGTCCCAGCT

AAGCGTGCAGGAAGATGTGAAGATTTAAGCTGTTCCTCTGCCTACACAAAGAACCTGGGCAGTGAGGATGACTGCAGCCACCGTGCAAGCGTCGTGGAGG

CCTACCTCTTGTTTCTGCCCGGCCCTCTGGCCAGAGCCCTGGCCTGCAAGAGGGACAGAGCCTGGGAGACGCGCACTCCCGTTGGGTTTGAGACAGACAC

TTTTTATATTTACCTCCTGATGGCATGGAGACTCTGAGCAAATCATGTAGACAACTCAATGCCACAACTCAAACTGCTTGCAGTGGGAAGTACAGAGAGC

CCAGTGCATCTGGCGTGTTGCCAGGAGCGGTGAAGGGTGCTGGGCTCGCCCAGGAGCGGCCCCCATACCTTGTGGTCCACTGGGCTGCAGGTTTTCCTCC

AGGGACCAGTCAACTGGCATCAAGATATTGAGAGGAACCGGAAGTTTCCTCCCTCCTTCCCGTAGGCAGTCCTGAGCCACACCATCCCTTCTCATGGACA

TCCGGAGGGACTGCCCCTAGAGACACAACCTGCTGCCTGTCTGTCCAGCCAAGTGCGCATGTGCCGAGGTGTGTCCCACATTGTGCCTGGTCTGTGCCAC

GCCCGTGTGTGTGTGTGTGTGTGTGAGTGAGTGTGTGTGTGTACACTTAACCTGCTTGAGCTTTCTGTGCATGTGTAGGCCAGGGTGTGGTGGCCATACT

GTCTCTGAGTGCTGCTGCTTCTCAGTGAGCAGCATGTAGTTAACCTGGTGCCCTCCTAGGTGTCTCCTGTCCCCAGACCCCATCAGTCAGGGAGGTTCTG

TCTTCTCAGCAGGCTGCTTGCCCACCCTGTGTCACAGGCCCTCCTCTTCCATTTCAGACCAGAACCAAAGCTGGCCCACTTGTCCATGGTAGGAGAAGCT

TTTGGGTCAAAATGAGGGGGACTTGATGAGCAGAGAGAGAATGTAGGTGGAAGTCTTGGGTGCTGTGTTTCAGCATCAGCCATGGGAAATGAGCCAGCCC

AAGGGCATCTTCCTTGACAGCTGTGAGGAAGGGCCGAGGAATCCGAAGCCAGAGCTTGGGACTCAGATTGGAATGTAACATCTGTTTATGTCCCACCCCA

GATTCTGCAAACTGCAGTGTATATTTTTGGTGGTGGGTTTGGGGTGGGAAGGGATGGGTTGCAGGGCGTGGGGAGGGAGGCTGGGGTGGGAGGGAGGCAT

CTGCATGGGCTTCTTGTACTGGATTCTCTGATCAGGGTAGAGAAGAGGCAAGGCTTGCATCCACTTCAGGGTCCCTACTGAGGAGAGTGAGCGGTCCGAG

CTGAATATGGTGTTTAACCTAAGTTTAGTATTTAATGAATTCTAGAAGCCTGGCTGTGGGTGGTGATTTGGTCAGCATATCTTAGGTATATAATAACTTT

GAAGCCATAACTTTTTAACTGGAGTGGTTTATTTTAATTCAGTTTATTTTATTTTATTTTGGGGGGAGGGTCAGGATTTTAACTTTAATATTGTTAAGTT

TTGTAAAAGGAGAACCATCTCTGTGACAATTACCTCTTAGTCTGTTTGTTTTTAAAGAAATCCCTAAAACAAACAAAACACAAAAATTCTCCAGACTCAA

ACGCACATAGTTCAGTCACTGGAAACGCTTGTCTTTGCACCTGAGCCTGATCCCGCTGAGCAGTGAGGGCTGCTTTTCCCCATGGGGGCTTGCTGTCTCG

TACTCCCTGCACCCTCGGCCCCATCCCGTGAGCACCTCGGCCCTCTGCACATTGCCCGGCTGGTTGGACCCTTTCCAGATACTTGCTCAGCAAATGTGGG

CTGCGAGCCTGCTGAGCGCTGGCCCGGGAGGATCTCCTCAGGGTGGGGCAGGCTTGGGCGCTGCTCTGCTCCTCTACCACTGGAGGGAATGGAATCATGC

GATGGGCGAGCACCTGCTGTGGAGACCAGAAGTGCTCATGGCTGGTCCTGAGAGCCTTGATGAGCTAGGATCACTGTTCTTAAAGACCACTGAAACTGGA

AGGGGGACCTGTATCCCCTTGGGAAGAGAAGCCCCTGGCAAGCAGTGGGTCCTGGAGACTGGGTTCATTGTGAGCCTTTCCTGCCAGGGGAGGCATGAGT

CTTTGCAGGGAAACTGTCTCCTCCAGCTTCTCCTGCCTTGGTCTCCCCATATTCTTAGCCTTTCTATTTATTTCCTGGTGTATAACTTTCCTTGCTTTAA

AGGGATCTTCCTTTAATTCCTTGGGCCAATTTACTGGCCATTGAACAGTGTCCCTTGAGTCCCAACTGTGTCTCTGGGGAACCTCCTTACCCACCCCTGC

TGACCTCCCACTTCCCACCCTGCAGCTGAGTATCCGTGATTACAGGCGATTGAACTGTAGAGTCCTCTCTGCCTCTGTACCTGCCAGCAGCAGCCTCACA

GTGACCCCCACGCCACTGGACAACTCCCAGGAGACCTGTGCGCTCCGTGCAGCTCAGCTCAGCCGCCTCTCAGGAAGCCTGGAGCAGGTCTGGGGGACCC

CCCCCCCATCACTCTTTACATTAAGCTGAGAGTTGGGAGAAGCTGTGCTTTGGCTCCCTGAGGCCACCCTGATCCACGGGGCACCCGCACCTCTGCGTTC

TGGATTCACAGACCAAGTCTAAAGCCCGTTCGTTCCTGAGTTGCCGTCAAGGCCCCTGAACGGTACTCTCGGTACTTCTGTTTGTTTTTTGTACAATTTA

TTAGAAAGGACTGTAAAATAGCCACTTAGACACTTTACCTCTCCAGTATGCAAATGTAAATATATTGTAATATAGGAAATTTTTGTTTTAATATAAGAAT

GAGCCTGTCCAGTTTCTGCTGTACATTATTAAAGTTTTATTCAC
Translation
MAESAGASSFFPLVVLLLAGSGGSGPRGIQA - UNI17860 - ALLCACTSCLQTNYTCETDGACMVSIFNLDGVEHHVRTCIPKVELVPAGKPFYCL

SSEDLRNTHCCYIDFCNKIDLRVPSG GHLKEPAHPSMWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQDLV

YDLSTSGSGSG GLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKD - UNI6572

 - DNGTWTQLWLVSDYHEHGSLFDYLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQG - UNI10091 - GKPGIAHRDLKSKNILVKKNGMCAIA

DLGLAVRHDAVTDTIDIAPNQRVGTKR RYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSGG - UNI8601 - GVHEDYQLPYYDLVPS

DPSIEEMRKVVCDQKLRPNVPNWWQSYE - UNI886 - ALRVMGKMMRECWYANGAARLTALRIKKTLSQLSVQEDVKI

For any suggestions or comments, please send an email to unitrap@crg.es