Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000555 (Itga5)
Chromosomal location
Chr 15: 103174720 - 103197194 (-)
Description
integrin alpha 5 (fibronectin receptor alpha) Gene [Source:MGI Symbol;Acc:MGI:96604]
RefSeq_dna
NM_010577 
RefSeq_peptide
NP_034707.2 
MGI
MGI:96604 
Uniprot/SWISSPROT
P11688 
Uniprot/SPTREMBL
Q3U7M6 Q80YP5 
Human Ortholog
ENSG00000161638 (ITGA5)
Omim not available
UniTrap UNI11222
Vector Insertion
Chr 15: 103189612 - 103196730
Public Clones P070B07 (ggtc) M090E03 (ggtc) P069E08 (ggtc) G035F09 (ggtc) P069C08 (ggtc)
IST14459H12 (tigm) IST10936A1HMF1 (tigm) IST10201A3 (tigm) IST14234H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023128
Sequence
CCAGCTGGGGCCGGAGCCAGGGTTCAGAGGTGCGGCCCCCCACGCCCCTTCGGGTGCGGGGCGCGGCCTCGGCGTCCCCGGGACCCAGGAATGCCCCCCC

GCCAGCCGGCCCGGCGGCCGGGGGGAGGGCCCAGCCGGGAGTTTGGCAAACTCCTCCCCGCGTTGAGTCATTCGCCTCTGGGAGGTTTAGGAAGCGGCTC

CGGGTCGGTGGCCCCAGGACAGGGAAGAGCGGGCACTATGGGGAGCTGGACGCCACGGTCGCCTCGATCTCCTCTCCACGCGGTGCTGCTGCGCTGGGGG

CCCCGACGCCTACCGCCGCTGCTGCCTCTGCTGCTGCTACTGTGGCCGCCACCACTCCAGGTTGGGGGCTTCAACCTAGACGCGGAGGCCCCGGCGGTGC

TCTCCGGGCCCCCCGGCTCCCTTTTTGGCTTCTCCGTGGAGTTTTACCGGCCGGGAAGGGACGG - UNI11222 - AGTCAGTGTGCTGGTTGGGGCA

CCCAAGGCTAACACTAGCCAGCCAGGTGTACTGCAAGGTGGTGCTGTCTATGTGTGTCCCTGGGGCACCAGTCCTATCCAGTGCACCACCATTCAATTTG

ACAGCAAAG GCTCCCGGATTCTGGAGTCCTCACTGTACAGTGCCAAGGGAGAGGAGCCTGTGGAGTACAAGTCCTTGCAGTGGTTCGGAGCAACAGTTC

GGGCCCATGGCTCCTCCATCTTG GCATGTGCTCCACTGTATAGCTGGCGCACAGAAAAGGACCCACAGAATGACCCAGTGGGCACCTGCTACCTCTCCA

CAGAAAACTTCACCCGGATTCTGGAGTACGCACCTTGCCGCTCAG ATTTTGGCAGTGCAGCAGGGCAGGGCTACTGCCAAGGGGGCTTCAGTGCTGAGT

TCACCAAG ACTGGCCGTGTGGTCCTGGGTGGACCTGGAAGCTACTTCTGGCAAG GCCAGATCCTGTCCGCCACTCAAGAGCAGATCTCGGAGTCCTAT

TACCCAGAGTATCTCATCAACCCTGTTCAGGGGCAGCTGCAGACCCGCCAGGCCAGCTCCGTCTATGATGACAGCTACTTGG GATACTCTGTGGCTGTG

GGTGAATTCAGTGGTGATGACACAGAAG ACTTTGTTGCTGGCGTGCCCAAGGGGAACCTCACCTATGGCTAT GTCACCGTCCTTAATGGCTCAGACAT

CCACTCCCTCTACAACGTCTCAGGAGAACAG ATGGCCTCCTACTTCGGCTATGCTGTGGCTGCCACTGATACCAATGGAGATGG GCTAGATGACCTAC

TGGTAGGGGCACCCCTGCTCATGGAGCGGACAGCTGATGGGAGACCTCAGGAGGTGGGCAGGGTCTACATCTATCTGCAGCGCCCAGCGGGCATAGATCC

CACACCCACCCTCACCCTCACTGGGCAAGATGAGTTCAGCCGATTCGGCAGCTCCTTGACACCCTTGGGGGACCTGGACCAAGACGGCTACAATG ATGT

CGCCATTGGGGCTCCATTTGGTGGGGAGGCCCAGCAGGGAGTCGTATTTATATTCCCGGGAGGCCCAGGAGGACTGAGCACTAAACCTTCCCAGGTTTTG

CAGCCTCTTTGGGCAGCTGGCCGTACCCCAGACTTCTTTGGCTCTGCCCTTCGAGGAGGACGAGATCTGGATGGCAATGGATACCCTG ATCTAATCGTT

GGATCCTTTGGTGTGGACAAGGCTCTGGTGTACAG AGGGCGGCCCATCATATCTGCCAGCGCATCTCTCACCATCTTCCCCTCCATGTTCAACCCAGAG

GAGCGCAGTTGCAGCCTGGAAGGGAACCCTGTGTCCTG CATCAACCTTAGCTTCTGCCTCAATGCCTCTGGAAAACATGTCCCCAACTCTATAG GCTT

CGAGGTGGAACTCCAACTGGACTGGCAGAAGCAAAAGGGAGGGGTCCGGCGGGCACTGTTCCTGACTTCCAAGCAGGCCACCCTTACCCAGACCCTGCTT

ATCCAGAATGGGGCTCGGGAGGACTGCAGGGAGATGAAGATCTACCTCAGG AATGAATCAGAATTCAGAGACAAACTCTCCCCAATTCACATTGCCCTC

AACTTCTCCTTGGACCCCAAAGCTCCCATGGACAGCCATGGCCTCCGGCCAGTTCTACACTACCAAAGCAAAAGCAGGATAGAGGACAAG GCCCAGATC

TTGCTGGACTGTGGTGAAGACAATATCTGTGTGCCTGACCTGCAGCTGGATGTGTATGG GGAGAAGAAACATGTGTACCTGGGTGACAAGAACGCACTG

AACCTGACATTCCATGCCCAAAATCTGGGTGAGGGCGGTGCCTATGAAGCCGAGCTTCGGGTCACAGCCCCTCTAGAGGCCGAGTACTCAGGACTTGTCA

GACACCCAGGG AACTTCTCCAGCCTGAGCTGTGACTACTTTGCTGTGAACCAGAGCCGCCAGCTGGTGTGTGACCTGGGCAACCCCATGAAGGCAGGCA

CCAGT CTCTGGGGTGGCCTTCGGTTCACTGTTCCTCATCTTCAAGACACAAAGAAAACCATCCAGTTTGACTTTCAGATCCTCAG CAAGAACCTGAAC

AACTCACAAAGCAACGTGGTCTCCTTCCCACTCTCGGTGGAGGCTCAAGCCCAGGTCTCCCTTAATGG TGTCTCCAAGCCTGAAGCTGTGATTTTCCCA

GTCAGCGACTGGAATCCTCAAGACCAGCCTCAGAAGGAGGAAGACTTGGGCCCAGCTGTCCACCATGTCTACGAG CTCATCAACCAGGGGCCCAGCTCC

ATCAGCCAGGGTGTGCTGGAGCTCAGCTGTCCACAGGCTCTGGAAGGCCAACAGCTCCTCTATGTGACCAAGGTGACAGGACTCAGCAACTGCACCTCCA

ACTACACCCCCAACTCACAGGGCCTGGAG TTGGATCCAGAGACCTCTCCACACCACCTGCAGAAACGAGAGGCTCCAGGGAGGAGTTCTACTGCCTCAG

GAACACAAGTTCTG AAATGCCCTGAAGCCAAGTGTTTCAGGCTGCGCTGTGAGTTTGGGCCACTGCACCGCCAAGAGAGCCGTAGTCTGCAGCTGCATT

TCCGAGTCTGGGCCAAGACCTTCTTGCAG CGGGAATACCAGCCATTTAGCCTTCAGTGTGAGGCTGTATATGAAGCTCTGAAGATGCCCTACCAGATCC

TGCCTCGGCAGCTTCCCCAAAAGAAACTTCAG GTGGCCACAGCCGTGCAGTGGACCAAGGCAGAAGGCAGCAATGGTGTCCCGTTGTGGATCATCATCC

TAGCCATTCTTTTTGGCCTCCTGCTCCTAGGTCTGCTCATCTACGTCCTCTACAAG CTCGGCTTCTTCAAACGTTCCCTCCCCTACGGCACAGCCATGG

AAAAAGCTCAGCTCAAGCCTCCAGCCACCTCAGATGCCTGAGCCCTCCTGATCTCAGACTCATGATCCCGAAGAGCCAGTCCAATACCTTCCGACAGGGA

GGGACTAGGCACTTCCTGAAGGTGCTGAGGGCTGGGGAGAAGCTCTTCTTCCTAGCCCAGAGACATACTTGAAGGGCCAGAGCTGGGGGGCAAGAAGCTT

GTGGATCCTTCCCCCCATGCACTGTGAAGGACCCTCGTTTACACATGCCCTCTCGTGGATGGGGGCCTCAGGTCCAGGGACAGAAGCTCCAGCTTTCCTT

CAGCCTTTGCATTTTGGAGACTTTTCTGAAATCAACTTGGAACCATAATTAGGGAATCCAGTTGTGGTTCTCTGGGCCGGGCATGCCAACAGGACTTCCC

ATCTGACTCCGGCCTGCAAAGATGCATCTTTGGTCTTGCCAGAGAACCAAAGGAAGTCTGCAGCTAAGAGCCTGAGACTTGGGGAGTGAGACCTGGCAAC

TCCAACAGCCCCCATCCTGGAAGGCCAATGAAGAACACTAACCGTGGATGGTGCTGCAGGACCAGCTCAGGACAAATCCCAAACAAAGGTCGATGCTGGC

CCAGACCCAGATCCATGGAAGTCAGAAAGAGAATGGAGCCAGACCCAGTCTGGGGCCTAGGGTTGATCTGGAGCCCAGTCTCGGATTCTAAGAACCTATG

CTAGCAGACCCAAGGTGGCATTTGGGTCAGCTGCAGACCTGGGCTTAGAAACCTATTTATCCCTGACTTAGGACAAGTCAGGAATTGCCCAGGACCCTAA

CCAGGCCACATTGGCAAACAGACCTGGAACCTCAGCCTGGCCACTCATTCCCCAGAGAGAACGGGAAGCCCCAGGCCTGTATGACCTGGGTTCTGCCCAC

CAGCTGCACTGACGCTGCCCCTCTCTCCCTAGCCAACCCTCCCCTCTCCTCCAGAACCCACCCCAACTTATTTAAACTCTGTTGCAAGTGCAATAAACCC

CACCCACTGCCCCCACTGACC
Translation
MGSWTPRSPRSPLHAVLLRWGPRRLPPLLPLLLLLWPPPLQVGGFNLDAEAPAVLSGPPGSLFGFSVEFYRPGRDG - UNI11222 - GVSVLVGAPK

ANTSQPGVLQGGAVYVCPWGTSPIQCTTIQFDSKG GSRILESSLYSAKGEEPVEYKSLQWFGATVRAHGSSIL ACAPLYSWRTEKDPQNDPVGTCYLS

TENFTRILEYAPCRSD DFGSAAGQGYCQGGFSAEFTK TGRVVLGGPGSYFWQG GQILSATQEQISESYYPEYLINPVQGQLQTRQASSVYDDSYLG 

GYSVAVGEFSGDDTED DFVAGVPKGNLTYGY VTVLNGSDIHSLYNVSGEQ MASYFGYAVAATDTNGDG GLDDLLVGAPLLMERTADGRPQEVGRVY

IYLQRPAGIDPTPTLTLTGQDEFSRFGSSLTPLGDLDQDGYND DVAIGAPFGGEAQQGVVFIFPGGPGGLSTKPSQVLQPLWAAGRTPDFFGSALRGGR

DLDGNGYPD DLIVGSFGVDKALVYR RGRPIISASASLTIFPSMFNPEERSCSLEGNPVSC CINLSFCLNASGKHVPNSIG GFEVELQLDWQKQKGG

VRRALFLTSKQATLTQTLLIQNGAREDCREMKIYLR NESEFRDKLSPIHIALNFSLDPKAPMDSHGLRPVLHYQSKSRIEDK AQILLDCGEDNICVPD

LQLDVYG GEKKHVYLGDKNALNLTFHAQNLGEGGAYEAELRVTAPLEAEYSGLVRHPG NFSSLSCDYFAVNQSRQLVCDLGNPMKAGTS LWGGLRFT

VPHLQDTKKTIQFDFQILS SKNLNNSQSNVVSFPLSVEAQAQVSLNG GVSKPEAVIFPVSDWNPQDQPQKEEDLGPAVHHVYE LINQGPSSISQGVL

ELSCPQALEGQQLLYVTKVTGLSNCTSNYTPNSQGLE LDPETSPHHLQKREAPGRSSTASGTQVL KCPEAKCFRLRCEFGPLHRQESRSLQLHFRVWA

KTFLQ REYQPFSLQCEAVYEALKMPYQILPRQLPQKKLQ VATAVQWTKAEGSNGVPLWIIILAILFGLLLLGLLIYVLYK LGFFKRSLPYGTAMEKA

QLKPPATSDA

For any suggestions or comments, please send an email to unitrap@crg.es