Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000568 (Hnrnpd)
Chromosomal location
Chr 5: 100390028 - 100407957 (-)
Description
heterogeneous nuclear ribonucleoprotein D Gene [Source:MGI Symbol;Acc:MGI:101947]
RefSeq_dna
NM_007516 NM_001077266 NM_001077265 
RefSeq_peptide
NP_031542.2 NP_001070735.1 NP_001070734.1 NP_001070733.1 
UniGene
Mm.411319 Mm.150231 
MGI
MGI:101947 
Uniprot/SWISSPROT
Q60668 
Uniprot/SPTREMBL
Q3UXC8 
Human Ortholog
ENSG00000138668 (HNRNPD)
Omim not available
UniTrap UNI10932
Vector Insertion
Chr 5: 100405610 - 100407410
Public Clones P001G09 (ggtc) P120E06 (ggtc) P109E09 (ggtc) P013C06 (ggtc) D008G09 (ggtc)
P111H05 (ggtc) P011H11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21706
Vector Insertion
Chr 5: 100396407 - 100405552
Public Clones D042H04 (ggtc) D051F02 (ggtc) D156B03 (ggtc) CMHD-GT_505F4-3 (cmhd) CMHD-GT_477B8-3 (cmhd)
Private Clones OST320485 (lexicon) OST313393 (lexicon) OST262178 (lexicon) OST147706 (lexicon)
OST67798 (lexicon) OST60489 (lexicon) OST57564 (lexicon) OST43218 (lexicon)
OST41439 (lexicon) OST39929 (lexicon) OST32413 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2881
Vector Insertion
Chr 5: 100395203 - 100396237
Public Clones AC0250 (sanger) AE0299 (sanger)
Private Clones OST241910 (lexicon) OST43072 (lexicon)
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37432
Vector Insertion
Chr 5: 100393688 - 100395203
Public Clones PST23127-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12712
Vector Insertion
Chr 5: 100393103 - 100393688
Public Clones F010D02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14810
Vector Insertion
Chr 5: 100391533 - 100392897
Public Clones PST13284-NL (escells) PST14770-NR (escells) PST2316-NR (escells) PST14277-NL (escells)
PST14277-NR (escells)
Private Clones OST349615 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28454
Vector Insertion
Chr 5: 100390353 - 100391533
Public Clones not available
Private Clones OST30581 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000072750
Sequence
CCATTTTAGGTGGTCCGCGGCGGCGCCATTAAAGCGAGGAGGAGGCGAGAGTGGCCGCCGCTGCTACTTCATTCTTTTTTTTTTCAGTGCAGCCGGGGAG

AGCGAGAGAGCGCGCTGCGCGAGAGTGGGAGGCGAGGGGGGCAGGCCGGGGAGAGGCGCAGGAGCCCTTGCAGCCACGCGCGCGCCTTGTCTAGGGTGCC

TCGCGAGGTAGAGCGGGCATCGCGCGGCGGCGGCGGGGATTACTTTGCTGCTAGTTTCGGTTCGCGGCGGCGGCGGCGTCGGCGGGTGTCGTCTTCGGCG

GCGGCAGTAGCACTATGTCGGAGGAGCAGTTCGGAGGGGACGGGGCGGCGGCGGCGGCAACGGCGGCGGTAGGCGGCTCGGCGGGCGAGCAGGAGGGAGC

CATGGTGGCGGCGGCGGCGCAGGGGCCGGCGGCGGCGGCGGGAAGCGGGAGCGGCGGCGGCGGCTCTGCGGCCGGAGGCACCGAAGGAGGCAGCGCCGAG

GCAGAGGGAGCCAAGATCGACGCCAGTAAGAACGAGGAGGATGAAGG - UNI10932 - CCATTCAAACTCCTCCCCACGACACACTGAAGCAGCGGC

GGCACAGCGGGAAGAATG - UNI21706 - GAAAATGTTTATAGGAGGCCTTAGCTGGGACACCACAAAGAAAGATCTGAAGGACTACTTTTCCAAAT

TTGGTGAAGTTGTAGACTGCACTCTGAAGTTAGATCCTATCACAGGGCGATCAAGGGGTTTTGGCTTTGTGCTATTTAAAGAGTCGGAGAGTGTAGATAA

G - UNI2881 - GTCATGGATCAGAAAGAACATAAATTGAATGGGAAAGTCATTGATCCTAAAAGGGCCAAAGCCATGAAAACAAAAGAGCCTGTCAA

AAAAATTTTTGTTGGTGGCCTTTCTCCAGACACACCTGAAGAAAAAATAAGAGAGTACTTTGGTGGTTTTGGTGAG GTTGAATCCATAGAGCTCCCTAT

GGACAACAAGACCAATAAGAGGCGTGGGTTCTGTTTTATTACCTTTAAGGAAGAGGAGCCAGTGAAGAAGATAATGGAAAAGAAATACCACAATGTTGGT

CTTAGTAAA - UNI12712 - TGTGAAATAAAAGTAGCCATGTCAAAGGAACAGTATCAGCAGCAGCAGCAGTGGGGATCTAGAGGAGGGTTTGCAGG

CAGAGCTCGCGGAAGAGGTGGAG - UNI14810 - ATCAGCAGAGTGGTTATGGGAAAGTATCCAGGCGAGGTGGACATCAAAATAGCTACAAACCAT

ACTAAATTATTCCATTTGCAACTTATCCCCAACAG - UNI14810 - - UNI28454 - GTGGTGAAGCAGTATTTTCCAATTTGAAGATTCATTTG

AAGGTGGCTCCTGCCACCTGCTAATAGCAGTTCAAACTAAATTTTTTCTATCAAGTTCCTGAATGGAAGTATGACGTTGGGTCCCTCTGAAGTTTAATTC

TGAGTTCTCATTAAAAGAATTTGCTTTCATTGTTTTATTTCTTAATTGCTATGCTTCAGTATCAATTTGTGTTTTATGCCCCCCCTCCCCCCCAGTATTG

TAGAGCAAGTCTTGTGTTAAAAAAAGCCCAGTGTGACAGTGTCATGATGTAGTAGTGTCTTACTGGTTTTTTAATAAATCCTTTTGT
Translation
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAAQGPAAAAGSGSGGGGSAAGGTEGGSAEAEGAKIDASKNEEDEG - UNI10932 - GHSNSSPR

HTEAAAAQREEW - UNI21706 - WKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDK - UNI2881 - VMDQ

KEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGE VESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSK - UN

I12712 - CEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGD - UNI14810 - DQQSGYGKVSRRGGHQNSYKPY - UNI14810 - - UNI28

454 - 
Transcript ENSMUST00000112939
Sequence
CCATTTTAGGTGGTCCGCGGCGGCGCCATTAAAGCGAGGAGGAGGCGAGAGTGGCCGCCGCTGCTACTTCATTCTTTTTTTTTTCAGTGCAGCCGGGGAG

AGCGAGAGAGCGCGCTGCGCGAGAGTGGGAGGCGAGGGGGGCAGGCCGGGGAGAGGCGCAGGAGCCCTTGCAGCCACGCGCGCGCCTTGTCTAGGGTGCC

TCGCGAGGTAGAGCGGGCATCGCGCGGCGGCGGCGGGGATTACTTTGCTGCTAGTTTCGGTTCGCGGCGGCGGCGGCGTCGGCGGGTGTCGTCTTCGGCG

GCGGCAGTAGCACTATGTCGGAGGAGCAGTTCGGAGGGGACGGGGCGGCGGCGGCGGCAACGGCGGCGGTAGGCGGCTCGGCGGGCGAGCAGGAGGGAGC

CATGGTGGCGGCGGCGGCGCAGGGGCCGGCGGCGGCGGCGGGAAGCGGGAGCGGCGGCGGCGGCTCTGCGGCCGGAGGCACCGAAGGAGGCAGCGCCGAG

GCAGAGGGAGCCAAGATCGACGCCAGTAAGAACGAGGAGGATGAAGG - UNI10932 - - UNI21706 - GAAAATGTTTATAGGAGGCCTTAGCT

GGGACACCACAAAGAAAGATCTGAAGGACTACTTTTCCAAATTTGGTGAAGTTGTAGACTGCACTCTGAAGTTAGATCCTATCACAGGGCGATCAAGGGG

TTTTGGCTTTGTGCTATTTAAAGAGTCGGAGAGTGTAGATAAG - UNI2881 - GTCATGGATCAGAAAGAACATAAATTGAATGGGAAAGTCATTGA

TCCTAAAAGGGCCAAAGCCATGAAAACAAAAGAGCCTGTCAAAAAAATTTTTGTTGGTGGCCTTTCTCCAGACACACCTGAAGAAAAAATAAGAGAGTAC

TTTGGTGGTTTTGGTGAG GTTGAATCCATAGAGCTCCCTATGGACAACAAGACCAATAAGAGGCGTGGGTTCTGTTTTATTACCTTTAAGGAAGAGGAG

CCAGTGAAGAAGATAATGGAAAAGAAATACCACAATGTTGGTCTTAGTAAA - UNI12712 - TGTGAAATAAAAGTAGCCATGTCAAAGGAACAGTA

TCAGCAGCAGCAGCAGTGGGGATCTAGAGGAGGGTTTGCAGGCAGAGCTCGCGGAAGAGGTGGAG - UNI14810 - GCCCCAGTCAAAACTGGAACC

AGGGATATAGTAACTATTGGAATCAAGGCTATGGCAACTATGGATATAACAGCCAAGGTTACGGAGGTTATGGAGGATATGACTACACTGGTTACAACAA

CTACTATGGATATGGTGATTATAGCA - UNI14810 - ATCAGCAGAGTGGTTATGGGAAAGTATCCAGGCGAGGTGGACATCAAAATAGCTACAAAC

CATACTAAATTATTCCATTTGCAACTTATCCCCAACAG - UNI14810 - - UNI28454 - GTGGTGAAGCAGTATTTTCCAATTTGAAGATTCAT

TTGAAGGTGGCTCCTGCCACCTGCTAATAGCAGTTCAAACTAAATTTTTTCTATCAAGTTCCTGAATGGAAGTATGACGTTGGGTCCCTCTGAAGTTTAA

TTCTGAGTTCTCATTAAAAGAATTTGCTTTCATTGTTTTATTTCTTAATTGCTATGCTTCAGTATCAATTTGTGTTTTATGCCCCCCCTCCCCCCCAGTA

TTGTAGAGCAAGTCTTGTGTTAAAAAAAGCCCAGTGTGACAGTGTCATGATGTAGTAGTGTCTTACTGGTTTTTTAATAAATCCTTTTGT
Translation
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAAQGPAAAAGSGSGGGGSAAGGTEGGSAEAEGAKIDASKNEEDEG - UNI10932 - - UNI217

06 - GKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDK - UNI2881 - VMDQKEHKLNGKVIDPKRAKAMKTK

EPVKKIFVGGLSPDTPEEKIREYFGGFGE VESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSK - UNI12712 - CEIKVAMSKEQY

QQQQQWGSRGGFAGRARGRGGG - UNI14810 - GPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSN - UNI14810 - 

NQQSGYGKVSRRGGHQNSYKPY - UNI14810 - - UNI28454 - 
Transcript ENSMUST00000019128
Sequence
CCATTTTAGGTGGTCCGCGGCGGCGCCATTAAAGCGAGGAGGAGGCGAGAGTGGCCGCCGCTGCTACTTCATTCTTTTTTTTTTCAGTGCAGCCGGGGAG

AGCGAGAGAGCGCGCTGCGCGAGAGTGGGAGGCGAGGGGGGCAGGCCGGGGAGAGGCGCAGGAGCCCTTGCAGCCACGCGCGCGCCTTGTCTAGGGTGCC

TCGCGAGGTAGAGCGGGCATCGCGCGGCGGCGGCGGGGATTACTTTGCTGCTAGTTTCGGTTCGCGGCGGCGGCGGCGTCGGCGGGTGTCGTCTTCGGCG

GCGGCAGTAGCACTATGTCGGAGGAGCAGTTCGGAGGGGACGGGGCGGCGGCGGCGGCAACGGCGGCGGTAGGCGGCTCGGCGGGCGAGCAGGAGGGAGC

CATGGTGGCGGCGGCGGCGCAGGGGCCGGCGGCGGCGGCGGGAAGCGGGAGCGGCGGCGGCGGCTCTGCGGCCGGAGGCACCGAAGGAGGCAGCGCCGAG

GCAGAGGGAGCCAAGATCGACGCCAGTAAGAACGAGGAGGATGAAGG - UNI10932 - CCATTCAAACTCCTCCCCACGACACACTGAAGCAGCGGC

GGCACAGCGGGAAGAATG - UNI21706 - GAAAATGTTTATAGGAGGCCTTAGCTGGGACACCACAAAGAAAGATCTGAAGGACTACTTTTCCAAAT

TTGGTGAAGTTGTAGACTGCACTCTGAAGTTAGATCCTATCACAGGGCGATCAAGGGGTTTTGGCTTTGTGCTATTTAAAGAGTCGGAGAGTGTAGATAA

G - UNI2881 - GTCATGGATCAGAAAGAACATAAATTGAATGGGAAAGTCATTGATCCTAAAAGGGCCAAAGCCATGAAAACAAAAGAGCCTGTCAA

AAAAATTTTTGTTGGTGGCCTTTCTCCAGACACACCTGAAGAAAAAATAAGAGAGTACTTTGGTGGTTTTGGTGAG GTTGAATCCATAGAGCTCCCTAT

GGACAACAAGACCAATAAGAGGCGTGGGTTCTGTTTTATTACCTTTAAGGAAGAGGAGCCAGTGAAGAAGATAATGGAAAAGAAATACCACAATGTTGGT

CTTAGTAAA - UNI12712 - TGTGAAATAAAAGTAGCCATGTCAAAGGAACAGTATCAGCAGCAGCAGCAGTGGGGATCTAGAGGAGGGTTTGCAGG

CAGAGCTCGCGGAAGAGGTGGAG - UNI14810 - GCCCCAGTCAAAACTGGAACCAGGGATATAGTAACTATTGGAATCAAGGCTATGGCAACTATG

GATATAACAGCCAAGGTTACGGAGGTTATGGAGGATATGACTACACTGGTTACAACAACTACTATGGATATGGTGATTATAGCA - UNI14810 - AT

CAGCAGAGTGGTTATGGGAAAGTATCCAGGCGAGGTGGACATCAAAATAGCTACAAACCATACTAAATTATTCCATTTGCAACTTATCCCCAACAG - U

NI14810 - - UNI28454 - GTGGTGAAGCAGTATTTTCCAATTTGAAGATTCATTTGAAGGTGGCTCCTGCCACCTGCTAATAGCAGTTCAAACTA

AATTTTTTCTATCAAGTTCCTGAATGGAAGTATGACGTTGGGTCCCTCTGAAGTTTAATTCTGAGTTCTCATTAAAAGAATTTGCTTTCATTGTTTTATT

TCTTAATTGCTATGCTTCAGTATCAATTTGTGTTTTATGCCCCCCCTCCCCCCCAGTATTGTAGAGCAAGTCTTGTGTTAAAAAAAGCCCAGTGTGACAG

TGTCATGATGTAGTAGTGTCTTACTGGTTTTTTAATAAATCCTTTTGT
Translation
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAAQGPAAAAGSGSGGGGSAAGGTEGGSAEAEGAKIDASKNEEDEG - UNI10932 - GHSNSSPR

HTEAAAAQREEW - UNI21706 - WKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDK - UNI2881 - VMDQ

KEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGE VESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSK - UN

I12712 - CEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGG - UNI14810 - GPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYY

GYGDYSN - UNI14810 - NQQSGYGKVSRRGGHQNSYKPY - UNI14810 - - UNI28454 - 

For any suggestions or comments, please send an email to unitrap@crg.es