Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000708 (Kat2b)
Chromosomal location
Chr 17: 53706640 - 53812045 (+)
Description
K(lysine) acetyltransferase 2B Gene [Source:MGI Symbol;Acc:MGI:1343094]
RefSeq_dna
NM_020005 
RefSeq_peptide
NP_064389.2 
UniGene
Mm.255025 
MGI
MGI:1343094 
Uniprot/SWISSPROT
Q9JHD1 
Uniprot/SPTREMBL
B2RR30 
Human Ortholog
ENSG00000114166 (KAT2B)
Omim not available
UniTrap UNI2494
Vector Insertion
Chr 17: 53706904 - 53750188
Public Clones XT0324 (sanger) (sanger) Xk351 (baygenomics) E127G05 (ggtc) E064A10 (ggtc)
D056E10 (ggtc) E114D10 (ggtc) E063F05 (ggtc) E085H10 (ggtc) M065B03 (ggtc)
E030H09 (ggtc) 3SE142B04 (ggtc) CMHD-GT_535C3-3 (cmhd) FHCRC-GT-S12-8H1 (fhcrc)
FHCRC-GT-S3-4C1 (fhcrc) PST19306-NR (escells) IST11222A1HMF1 (tigm) IST11526C6 (tigm)
IST10953B2 (tigm) IST10592H6 (tigm) IST12588E10 (tigm) IST11991D2 (tigm)
IST13053C6 (tigm) IST10415C7 (tigm) IST14985E10 (tigm) IST12106G3 (tigm)
IST12544C5 (tigm) IST14468D3 (tigm) IST11059C10 (tigm) IST10187B8 (tigm)
IST12092H11 (tigm) IST13050B10 (tigm) IST11295G11 (tigm) IST14165B4 (tigm)
IST12769E10 (tigm) IST11095H1 (tigm) IST10509C2 (tigm) IST11473D6 (tigm)
IST14264F7 (tigm) IST12092C6 (tigm) IST15102C12 (tigm) IST14813A12 (tigm)
Private Clones OST452444 (lexicon) OST430837 (lexicon) OST383922 (lexicon) OST378453 (lexicon)
OST369015 (lexicon) OST339840 (lexicon) OST329239 (lexicon) OST275777 (lexicon)
OST275637 (lexicon) OST262212 (lexicon) OST260879 (lexicon) OST252274 (lexicon)
OST234980 (lexicon) OST211918 (lexicon) OST202138 (lexicon) OST192356 (lexicon)
OST191869 (lexicon) OST191440 (lexicon) OST181668 (lexicon) OST178353 (lexicon)
OST168155 (lexicon) OST148475 (lexicon) OST131529 (lexicon) OST125269 (lexicon)
OST114794 (lexicon) OST77030 (lexicon) OST76533 (lexicon) OST65974 (lexicon)
OST55998 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9591
Vector Insertion
Chr 17: 53750316 - 53763676
Public Clones XD183 (baygenomics) IST14704C6 (tigm)
Private Clones OST412566 (lexicon) OST379176 (lexicon) OST280653 (lexicon) OST259851 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22239
Vector Insertion
Chr 17: 53763823 - 53768648
Public Clones not available
Private Clones OST302708 (lexicon) OST254950 (lexicon) OST222452 (lexicon) OST192219 (lexicon)
OST131582 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19211
Vector Insertion
Chr 17: 53768742 - 53771861
Public Clones not available
Private Clones OST401417 (lexicon) OST185005 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1902
Vector Insertion
Chr 17: 53793891 - 53798642
Public Clones AY0344 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000000724
Sequence
GACAGTCGGGGCGGCATGGCCGAGGCTGGCGGGGCCGGGTCCCCAGCACTGCCTCCCGCGCCCCCGCACGGTTCCCCCCGGACCCTGGCCACCGCTGCCG

GGAGCTCTGCTTCCTGCGGGCCAGCGACCGCGGTGGCCGCGGCGGGCACGGCCGAGGGACCGGGAGGAGGCGGCTCGGCCCGGATCGCCGTGAAGAAGGC

GCAGTTGCGCTCTGCTCCGCGGGCGAAGAAGCTGGAGAAACTCGGCGTGTACTCCGCCTGCAAG - UNI2494 - GCAGAGGAGTCCTGTAAATGCAA

TGGCTGGAAGAACCCTAACCCCTCTCCTACTCCACCAAGAGGAGACCTCCAGCAGATAATTGTCAGTTTGACAGAATCCTGTCGAAGCTGTAGCCATGCC

CTTG - UNI9591 - CTGCTCACGTTTCTCACTTGGAGAATGTGTCAGAGGAAGAGATGGACAGACTCCTGGGAATTGTGTTGGATGTGGAGTACCTC

TTCACCTGCGTCCACAAAGAAGAAGATGCAGATACCAAACAAGTGTACTTCTACCTATTCAAG - UNI22239 - CTCTTGAGAAAGTCAATTTTACA

AAGAGGAAAACCTGTGGTTGAAGGCTCCTTGGAGAAGAAGCCGCCATTTGAGAAGCCCAGTATTGAACAG - UNI19211 - GGTGTGAACAACTTCG

TGCAGTACAAGTTTAGTCACTTGCCATCGAAAGAGAGGCAGACAACGATCGAGCTGGCCAAGATGTTTCTGAACCGCATCAACTACTGGCATCTGGAGGC

TCCATCTCAGCGGAGACTACGGTCTCCCAATGATGACATCTCTGGATACAAGGAAAACTACACAAG GTGGTTGTGCTACTGCAATGTACCGCAGTTCTG

TGACAGCTTACCTCGGTACGAAACCACAAAGGTGTTTGGGAGAACATTGCTTCGCTCGGTCTTCACCATCATGAGACGACAGCTCTTGGAACAAGCCAGA

CAGGAAAAAGACAAACTGCCTCTTGAGAAACGCACGCTTATCCTCACACATTTCCCAAA GTTTCTGTCCATGTTGGAAGAAGAAGTGTATAGTCAAAAT

TCTCCTATCTGGGATCAGGATTTTCTCTCAGCCTCTTCCAGAACCAGCCCGCTAGGAATCCAAACAG TAATCAGTCCTCCTGTTACTGGGACAGCATTG

TTCAGTTCAAATTCCACTTCCCATGAGCAGATCAATGGAGGGAGAACAAGTCCTGGATGCAGAGGCTCTTCTGGGCTTGAAGCAAACCCGG GAGAAAAG

AGGAAAATGAACAACTCTCATGCTCCCGAGGAGGCCAAGAGATCTCGAGTGATGGGGGATATTCCCGTGGAATTGATCAATGAGGTCATGTCTACCATCA

CAGACCCTGCAGGGATGCTTGGACCAGAG ACCAATTTTCTGTCAGCCCATTCGGCCAGAGATGAGGCGGCACGGCTGGAAGAACGCAGGGGTGTCATTG

AATTCCACGTGGTGGGCAACTCCCTGAACCAGAAACCAAACAAGAAGATCCTGATGTGGCTCGTGGGCCTCCAGAATGTGTTTTCCCACCAGCTGCCCAG

AATGCCCAAAGAGTACATCACACGGCTCGTCTTTGACCC GAAACACAAAACCCTTGCTTTAATTAAAGATGGCCGTGTCATTGGTGGTATCTGTTTCCG

GATGTTTCCATCCCAGGGATTCACAGAGATTGTTTTCTGTGCAGTAACCTCAAATGAACAAGTCAAG - UNI1902 - GGCTATGGAACCCACCTGAT

GAACCATCTCAAAGAATACCACATAAAGCACGAGATCCTCAACTTCCTCACATATGCAGATGAGTATGCCATCGGCTATTTCAAGAAGCAG GGTTTCTC

CAAAGAAATCAAAATACCTAAAACCAAATATGTTGGCTACATCAAGGATTATGAAGGGGCCACTTTGATGGGATGTGAGCTGAACCCTCAGATCCCATAC

ACAGAGTTCTCTGTCATCATTAAAAAGCAGAAGGAG ATCATTAAAAAGCTGATAGAAAGAAAACAAGCCCAGATTCGAAAAGTCTACCCTGGACTTTCG

TGTTTCAAAGATGGAGTTCGGCAGATTCCTATAGAAAGCATTCCTGGAATCA GAGAGACAGGCTGGAAACCAAGTGGAAAAGAGAAAAG TAAAGAGCC

CAAAGACCCTGAGCAGCTTTACAGCACCCTCAAGAACATCCTGCAGCAGGTGAAG AACCATCCAAATGCTTGGCCTTTCATGGAACCAGTGAAGAGAAC

AGAAGCTCCGGGATATTATGAAGTTATAAGGTTCCCCATGG ATCTGAAAACCATGAGTGAACGCCTCAGGAACAGGTACTATGTGTCTAAGAAGTTATT

CATGGCGGACTTGCAACGAGTGTTCACCAACTGCAAGGAGTACAACCCTCCCGAGAGCGAGTACTACAAATGCGCCAGCATCCTGGAGAAGTTCTTCTTC

AGTAAAATTAAGGAAGCAGGGTTGATTGACAAGTGATTTCTTTCCCTTAGACACACATCAGCAGTGTGCCTAAAACAGGTCATTTAGGTTTTTGGTTGCT

TTTGTTTTTTTGTTTTTGTTTTTAAATTGTACATCATGTGTTGAAGAGACTTGTAATAATTAGCACTTTTGAAAAACAAACAAAACCTCCTTTTAGCTTT

TCAGAGACGTATTTAAATGGAAATCATAGATTTTTTTTTTATTTTGAGCAATAGATTTTAATCTATTTACTACTATCATGTAATTTTTCTCTGGCATGTC

CAGTAGCTGACTATTGCATGGTAGATGATCAGGGGCTTCCTCAAAACCTGTATGTGAGGAAATTGCACACAGTACCAAGATTTGGGGTAATCTAGAGAAA

AGTTTGACCATGAATGTCTCCATTTTTTTTCTAATGGAACATGAGAGTTTATTTTATTCTGAAGGACTTTAAAGGGTCCGTGACACACCTGTGCTGTGAA

TGAACTGTGTGATGTTTGAAGTCTCCTTGTAGACTTTTTATAAGTATATATTTTTAAAACACTCATCTAGATGAGGTGCTTTGAGCAGTTCTGAAAAAAA

AAAATGCAGCTTCCACAATAGCGGCTGCTATGACTCCTAAGGAAGGGACTTTTTATAAGCTCCTGGGGCTTTGATCATTCTGTCTACCTATTACAGACTT

GAGAGTGCACAACCACTATTTAATAATATCTTGGCAGATATGTGTCCATCTCATATTTGACTTTGCTTGTGCAGGGCCCAACTTCTAAAAGATCCGTTCC

CAGGCCACAAAGGTGTTAGCTTGAAAATATTTGAGGTTGAGTTAATGTTAAGACATGTGGCCTAAACATGAACCCAGGGGAGCCTTGCTTCACTATGTAA

GGATTCTTTGTATTTTCTGGTACATTTAACCCCATCACCAGTGTCTATGTGAACATTTCCCATTTGCACTTCCAGAGTTTTGTTTGTCTGAGGTGAACTG

AATTCTCACCAAAGTTTAGGCCAGTATTTTAACACCTCCATTGTTTTATTGGTCCAGGGTTATATCCCACTAACATTCGCTGTACAATCTTATTAACCAT

TTTTGTCTTGGGACTCCAGCTTAGTGCTTGGATTTATTTCCTAATTACACTACATAGAAAAGTGGGACACCTGCCAGCCCAACTCTGGGAAAAACCAACT

AATATACAACCATATTAAATGAAGGCCACCTTAATGGTCTCGACACTAATTTTTATGATGCAAATTTATAAACTGATTTTTTTGTAAAGGCTGAGGTTTT

AAAAATGTATTTAATGTATGTTTTCTATCCGCATAAATTATATTGGGTCACTAATAGTCATTAAAAATAGCTTGCAGAGGTAGTGTGCTTGAAGGAAAAT

ATCCTGGCATTGCTCCCGAGTGCTGCTTCTGACATGGAAGGCATGCTGTATGTTCATAGTGTTCACTGAAGATCACACTGAAGATGCCTCAACATTGGGA

AATGTAAGGAACACTTTGAGTGGTATCTAGACTATTAATGAAGAGTGATAATAGAGGCTGCATTAAGTGTCTCAGACTGGTTTTAAAACAGCTTTGTACC

GATTTCGCTGAAGCGTCTGTCCAGTTTGGTATCCTGTGAAAGTTTGTTATTTCCTGGGTAGACATCCTTAAAGAGTATTGTCTTTAAAATCAGATGGTCT

CTTCTATATTGAAAGCATTTTTATGTTTTCTAATTTAAAATTAATATTTTCTTATAGATATTGTGCAATAAAGCAGAAGTAGAATGTGGTTTTTGCAAAT

GCTTTAACGGCCGACAAAAACTTTACATTTGTAAAATTAATATATTGTACTGGTACAAAATAGTTTTAAATTATATTTTGAAAAGCTC
Translation
MAEAGGAGSPALPPAPPHGSPRTLATAAGSSASCGPATAVAAAGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACK - UNI2494 - AEES

CKCNGWKNPNPSPTPPRGDLQQIIVSLTESCRSCSHALA - UNI9591 - AAHVSHLENVSEEEMDRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLF

K - UNI22239 - LLRKSILQRGKPVVEGSLEKKPPFEKPSIEQ - UNI19211 - GVNNFVQYKFSHLPSKERQTTIELAKMFLNRINYWHLEAP

SQRRLRSPNDDISGYKENYTR RWLCYCNVPQFCDSLPRYETTKVFGRTLLRSVFTIMRRQLLEQARQEKDKLPLEKRTLILTHFPK KFLSMLEEEVYS

QNSPIWDQDFLSASSRTSPLGIQTV VISPPVTGTALFSSNSTSHEQINGGRTSPGCRGSSGLEANPG GEKRKMNNSHAPEEAKRSRVMGDIPVELINE

VMSTITDPAGMLGPE TNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDP PKHKTLALIKDGR

VIGGICFRMFPSQGFTEIVFCAVTSNEQVK - UNI1902 - GYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQ GFSKEIKIPKTKYVGYIKD

YEGATLMGCELNPQIPYTEFSVIIKKQKE IIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIR RETGWKPSGKEKS SKEPKDPEQLYSTLKN

ILQQVK NHPNAWPFMEPVKRTEAPGYYEVIRFPMD DLKTMSERLRNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCASILEKFFFSKIKEAGLID

K

For any suggestions or comments, please send an email to unitrap@crg.es