Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000751 (Rpa1)
Chromosomal location
Chr 11: 75113852 - 75161837 (-)
Description
replication protein A1 Gene [Source:MGI (curated);Acc:Rpa1-001]
RefSeq_dna
NM_026653 
RefSeq_peptide
NP_080929.1 
UniGene
Mm.472099 Mm.180734 
MGI
MGI:1915525 
Uniprot/SWISSPROT
Q8VEE4 
Uniprot/SPTREMBL
Q3U8B3 Q5SWN2 
Human Ortholog
ENSG00000132383 (RPA1)
Omim not available
UniTrap UNI2899
Vector Insertion
Chr 11: 75155697 - 75161727
Public Clones (sanger) AD0650 (sanger) CSH524 (baygenomics) RRK136 (baygenomics) CSH594 (baygenomics)
RRK137 (baygenomics) D129A06 (ggtc)
Private Clones OST454871 (lexicon) OST448599 (lexicon) OST385802 (lexicon) OST353867 (lexicon)
OST353866 (lexicon) OST318438 (lexicon) OST307151 (lexicon) OST277071 (lexicon)
OST201210 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24131
Vector Insertion
Chr 11: 75154609 - 75155645
Public Clones not available
Private Clones OST233398 (lexicon) OST225273 (lexicon) OST223998 (lexicon) OST185898 (lexicon)
OST102885 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22138
Vector Insertion
Chr 11: 75153901 - 75154529
Public Clones not available
Private Clones OST307213 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18441
Vector Insertion
Chr 11: 75132034 - 75142174
Public Clones IST10087B3 (tigm)
Private Clones OST423307 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15352
Vector Insertion
Chr 11: 75129606 - 75132034
Public Clones PST97-1 (escells)
Private Clones OST36737 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1158
Vector Insertion
Chr 11: 75123768 - 75125801
Public Clones BB0160 (sanger)
Private Clones OST57225 (lexicon)
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18262
Vector Insertion
Chr 11: 75116257 - 75119609
Public Clones not available
Private Clones OST426793 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000000767
Sequence
GTTGAGCAGCCCGCGGGACCCCGGCAGAGAAGCTCAGGCGGTGCAAGAGCGCGAGCGCGGGAGTTAGCGGTGCAGCCATGGTGGGACACCTGAGCGAGGG

GGCCATCGAG - UNI2899 - GTCATGATACAGCAGGAAAATACATCCATAAAGCCCATCCTGCAGGTCATT - UNI24131 - AACATCCGTCCC

ATTTCTACAGGGAATAGGTCACCCCGGTACCGACTGCTCATGAGTGATGGGTTGAACACGCTTTCCT - UNI22138 - CGTTCATGCTGGCCACGCA

GCTGAACACCCTGGTCGAGGGAGGGCAGCTGGCCAGCAACTGTGTCTGCCAGGTCCACAAGTTCATCGTCAACACCCTGAAAGACGGCAG AATGCAACC

AAAACCTCATGGGAATCCGTATGGTGAACAGTCAGTGCTGAGGAAGTTAAGCCA GAAAGTAGTTGTTTTGATGGACTTGGAAGTTATGAAATCTGCTGA

AGACGTTGGATTAAAGATTGGGAATCCAGTGCCCTATAATGAAG - UNI15352 - - UNI18441 - GATATGGGCAGCAGCAGCAGCAGCAGCAG

CAGCAGCAGCAGCAAGCAGTCCCTTCCCCAGCCTCTGCAGCGACACCACCAGCCAGCAAGCCCCAGCCACAGAATGGGAGTCTGGGAATGG - UNI153

52 - GTTCCACTGCAGCTAAGGCTTATGGTGCCTCAAAGCCATTTGGAAAACCTGCCGGAACTGGCCTGCTGCAGCCTTCAGGTGGGACACAGTCCAAA

GTGGTGCCCATCGCCAGCCTCACCCCGTACCAGTCCAA - UNI15352 - GTGGACTATTTGTGCCCGTGTCACCAACAAAAGTCAGATCCGCACCTG

GAGTAATTCCCGGGGGGAAGGAAAGCTTTTCTCTCTAGAACTTGTGGATGAAAGC GGTGAAATCAGAGCTACTGCTTTCAATGAGCAAGTGGACAAGTT

CTTTCCCCTTATTGAAGTGAACAAG GTGTATTACTTCTCAAAGGGCGCCCTGAAGATCGCTAACAAACAGTTCTCCGCTGTTAAAAATGACTATGAGAT

GACCTTCAATAATGAGACTTCTGTCCTTCCCTGTGAAGATGGCCATCACTTACCCACAGTTCAGTTTGATTTCACAGGGATCGGTGACCTAGAGAGCAAG

GCTAAAGACGCACTAGTAG ACATCATTGGAATCTGCAAGAGCTATGAAGATTCGATTAAAATCACAGTGAAGTCGAACAACAGAGAAGTTGCTAAGAGA

AATATCTATTTGATGGACATGTCAGGGAAGGTGGTGACCACAACTCTGTGGGGAGAAGAT GCTGACAAGTTTGACGGCTCTCGGCAGCCCGTGATGGCC

ATCAAAGGAGCCCGAGTCTCTGACTTCGGTGGACGGAGCCTCTCGGTCCTCTCATCCAGCACTGTCATTGTGAATCCTGACATCCCAGAGGCCTATAAGC

TTCGTGGCTG - UNI1158 - GTTTGACTCAGAAGGACAAGCCTTAGATGGTGTTTCCATCTCTGACCACAGGAGTGGAGGGGCCGGAGGGGGCAACA

CCAACTGGAAAACTTTGCATGAGGCTAAATCTGAGAACCTGGGCCAGGGAGACAAG GCGGACTATTTCAGCACTGTGGCAGCGGTGGTGTTTCTCCGCA

AAGAGAACTGTATGTACCAGGCCTGCCCAACCCAGGACTGCAATAAGAAAGTGATTGACCAGCAGAATGGGTTGTACCGCTGTGAGAAGTGTGACCGGGA

ATTTCCCAATTTCAAATACCGCATGATCTTATCG GCAAATATTGCAGATTTTCAAGAGAACCAGTGGGTGACGTGTTTCCAGGAGTCTGCAGAGGCCAT

CCTTGGACAGAACACTATGTACCTTGGGGAACTCAAAGAGAAG - UNI18262 - AACGAGCAGGCGTTTGAAGAGGTTTTCCAGAATGCCAACTTCC

GGTCATTTACGTTCAGAATCAGGGTCAAGCTGGAGACCTACAAT GATGAATCTCGAATTAAGGCCACTGTGATGGACGTGAAGCCCGTGGACTTCAGAG

ACTATGGCAGACGGCTGATCGCGAACATCAGGAAGAACATGTGATGGGAGCAAGTACCACTGGTGGCCAGAACGGAAGAGAGAAGAACAGAAATAGAATG

GCTTCCTTCCCGCCCCATGGGACAGCTCCACAATGAAGATCCTCTAGGGGAGGCTGGCAACCCATCTGGGCCCCTCTTGGGACTCACTGATAAGCAAAGA

CAGTGAGCTCAGAGGGCTGTGTGTGAACCTTCCGCTCCAGTTCTCAGCCACCGGTAGTGTGGCAGCAGTCCCCTCCTCCTGCCTTCCGGCTTTGTCGGAT

TTCATGAAATTTTGTTATCTTCAAACAGAAATTATGTCACAAGTCATTAACCCCACTCTGGATAATGAGGCAAATTATGTAACCTGGAGTGTGCTTTTCC

AGTGGTGGCACCTTTTTGTCTTGAGTTCCTCCTGGGGGGAGAAGAGTAGGGGAGAACCCAGGTGTTCAGAGGGTGCGTCTGCCTGGAATCAAAGGGTCTG

TTTTGCAGAGTTACTGCATGGTTGTTAATGCTTAGAATGGCAACAAGGTAGAATTATTAATCAAAGGCCTATCGTTAATATCTGAATATCCTTCCTTCAG

GGTTTGATAGGTTTAATAGACTGAGTCAGATGACTCTGATATTAATCAGAATTGTCTCCTCTGAGGACGGCTGATAAGCACTGGCTTGCTGTCCCCTTGG

GGAAAAGCAAACCCCCAAATTGCATAATTTACTTCATTATCCACATAGTGGGGTCAGTTACTTGAGACACAATCCCTGTTTGAAGATAACAGAATCTTAG

TAAATCCGACAAAGCCTGCAGACAGAGGTGGCACTGGGACATCCAGGCTGCTACAGAGCATGGCTTCAGTTTGCATCAGTTACCGTTCGGTTGCCAGGCG

GACCTGTGTACCTTTATTAAAGCTATGTTAAATAGAATTTAAGAAAGAAGCTTTGTTTCCTTTGCTTTGTTTGAATAAACAGTATATCTTTGTGGATCC
Translation
MVGHLSEGAIE - UNI2899 - VMIQQENTSIKPILQVI - UNI24131 - NIRPISTGNRSPRYRLLMSDGLNTLSS - UNI22138 - SFML

ATQLNTLVEGGQLASNCVCQVHKFIVNTLKDGR RMQPKPHGNPYGEQSVLRKLSQ QKVVVLMDLEVMKSAEDVGLKIGNPVPYNEG - UNI15352 

- - UNI18441 - GYGQQQQQQQQQQQQAVPSPASAATPPASKPQPQNGSLGMG - UNI15352 - GSTAAKAYGASKPFGKPAGTGLLQPSGGTQ

SKVVPIASLTPYQSK - UNI15352 - KWTICARVTNKSQIRTWSNSRGEGKLFSLELVDES GEIRATAFNEQVDKFFPLIEVNK VYYFSKGALKI

ANKQFSAVKNDYEMTFNNETSVLPCEDGHHLPTVQFDFTGIGDLESKAKDALVD DIIGICKSYEDSIKITVKSNNREVAKRNIYLMDMSGKVVTTTLWG

ED ADKFDGSRQPVMAIKGARVSDFGGRSLSVLSSSTVIVNPDIPEAYKLRGW - UNI1158 - WFDSEGQALDGVSISDHRSGGAGGGNTNWKTLHE

AKSENLGQGDK ADYFSTVAAVVFLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDREFPNFKYRMILS ANIADFQENQWVTCFQESAEAILGQNTM

YLGELKEK - UNI18262 - NEQAFEEVFQNANFRSFTFRIRVKLETYN DESRIKATVMDVKPVDFRDYGRRLIANIRKNM
Transcript ENSMUST00000092907
Sequence
GTTGAGCAGCCCGCGGGACCCCGGCAGAGAAGCTCAGGCGGTGCAAGAGCGCGAGCGCGGGAGTTAGCGGTGCAGCCATGGTGGGACACCTGAGCGAGGG

GGCCATCGAG - UNI2899 - GTCATGATACAGCAGGAAAATACATCCATAAAGCCCATCCTGCAGGTCATT - UNI24131 - AACATCCGTCCC

ATTTCTACAGGGAATAGGTCACCCCGGTACCGACTGCTCATGAGTGATGGGTTGAACACGCTTTCCT - UNI22138 - CGTTCATGCTGGCCACGCA

GCTGAACACCCTGGTCGAGGGAGGGCAGCTGGCCAGCAACTGTGTCTGCCAGGTCCACAAGTTCATCGTCAACACCCTGAAAGACGGCAG GAAAGTAGT

TGTTTTGATGGACTTGGAAGTTATGAAATCTGCTGAAGACGTTGGATTAAAGATTGGGAATCCAGTGCCCTATAATGAAG - UNI15352 - - UNI1

8441 - GATATGGGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAAGCAGTCCCTTCCCCAGCCTCTGCAGCGACACCACCAGCCAGCAAGCCCC

AGCCACAGAATGGGAGTCTGGGAATGG - UNI15352 - GTTCCACTGCAGCTAAGGCTTATGGTGCCTCAAAGCCATTTGGAAAACCTGCCGGAACT

GGCCTGCTGCAGCCTTCAGGTGGGACACAGTCCAAAGTGGTGCCCATCGCCAGCCTCACCCCGTACCAGTCCAA - UNI15352 - GTGGACTATTTG

TGCCCGTGTCACCAACAAAAGTCAGATCCGCACCTGGAGTAATTCCCGGGGGGAAGGAAAGCTTTTCTCTCTAGAACTTGTGGATGAAAGC GGTGAAAT

CAGAGCTACTGCTTTCAATGAGCAAGTGGACAAGTTCTTTCCCCTTATTGAAGTGAACAAG GTGTATTACTTCTCAAAGGGCGCCCTGAAGATCGCTAA

CAAACAGTTCTCCGCTGTTAAAAATGACTATGAGATGACCTTCAATAATGAGACTTCTGTCCTTCCCTGTGAAGATGGCCATCACTTACCCACAGTTCAG

TTTGATTTCACAGGGATCGGTGACCTAGAGAGCAAGGCTAAAGACGCACTAGTAG ACATCATTGGAATCTGCAAGAGCTATGAAGATTCGATTAAAATC

ACAGTGAAGTCGAACAACAGAGAAGTTGCTAAGAGAAATATCTATTTGATGGACATGTCAGGGAAGGTGGTGACCACAACTCTGTGGGGAGAAGAT GCT

GACAAGTTTGACGGCTCTCGGCAGCCCGTGATGGCCATCAAAGGAGCCCGAGTCTCTGACTTCGGTGGACGGAGCCTCTCGGTCCTCTCATCCAGCACTG

TCATTGTGAATCCTGACATCCCAGAGGCCTATAAGCTTCGTGGCTG - UNI1158 - GTTTGACTCAGAAGGACAAGCCTTAGATGGTGTTTCCATCT

CTGACCACAGGAGTGGAGGGGCCGGAGGGGGCAACACCAACTGGAAAACTTTGCATGAGGCTAAATCTGAGAACCTGGGCCAGGGAGACAAG GCGGACT

ATTTCAGCACTGTGGCAGCGGTGGTGTTTCTCCGCAAAGAGAACTGTATGTACCAGGCCTGCCCAACCCAGGACTGCAATAAGAAAGTGATTGACCAGCA

GAATGGGTTGTACCGCTGTGAGAAGTGTGACCGGGAATTTCCCAATTTCAAATACCGCATGATCTTATCG GCAAATATTGCAGATTTTCAAGAGAACCA

GTGGGTGACGTGTTTCCAGGAGTCTGCAGAGGCCATCCTTGGACAGAACACTATGTACCTTGGGGAACTCAAAGAGAAG - UNI18262 - AACGAGC

AGGCGTTTGAAGAGGTTTTCCAGAATGCCAACTTCCGGTCATTTACGTTCAGAATCAGGGTCAAGCTGGAGACCTACAAT GATGAATCTCGAATTAAGG

CCACTGTGATGGACGTGAAGCCCGTGGACTTCAGAGACTATGGCAGACGGCTGATCGCGAACATCAGGAAGAACATGTGATGGGAGCAAGTACCACTGGT

GGCCAGAACGGAAGAGAGAAGAACAGAAATAGAATGGCTTCCTTCCCGCCCCATGGGACAGCTCCACAATGAAGATCCTCTAGGGGAGGCTGGCAACCCA

TCTGGGCCCCTCTTGGGACTCACTGATAAGCAAAGACAGTGAGCTCAGAGGGCTGTGTGTGAACCTTCCGCTCCAGTTCTCAGCCACCGGTAGTGTGGCA

GCAGTCCCCTCCTCCTGCCTTCCGGCTTTGTCGGATTTCATGAAATTTTGTTATCTTCAAACAGAAATTATGTCACAAGTCATTAACCCCACTCTGGATA

ATGAGGCAAATTATGTAACCTGGAGTGTGCTTTTCCAGTGGTGGCACCTTTTTGTCTTGAGTTCCTCCTGGGGGGAGAAGAGTAGGGGAGAACCCAGGTG

TTCAGAGGGTGCGTCTGCCTGGAATCAAAGGGTCTGTTTTGCAGAGTTACTGCATGGTTGTTAATGCTTAGAATGGCAACAAGGTAGAATTATTAATCAA

AGGCCTATCGTTAATATCTGAATATCCTTCCTTCAGGGTTTGATAGGTTTAATAGACTGAGTCAGATGACTCTGATATTAATCAGAATTGTCTCCTCTGA

GGACGGCTGATAAGCACTGGCTTGCTGTCCCCTTGGGGAAAAGCAAACCCCCAAATTGCATAATTTACTTCATTATCCACATAGTGGGGTCAGTTACTTG

AGACACAATCCCTGTTTGAAGATAACAGAATCTTAGTAAATCCGACAAAGCCTGCAGACAGAGGTGGCACTGGGACATCCAGGCTGCTACAGAGCATGGC

TTCAGTTTGCATCAGTTACCGTTCGGTTGCCAGGCGGACCTGTGTACCTTTATTAAAGCTATGTTAAATAGAATTTAAGAAAGAAGCTTTGTTTCCTTTG

CTTTGTTTGAATAAACAGTATATCTTTGTGGATCC
Translation
MVGHLSEGAIE - UNI2899 - VMIQQENTSIKPILQVI - UNI24131 - NIRPISTGNRSPRYRLLMSDGLNTLSS - UNI22138 - SFML

ATQLNTLVEGGQLASNCVCQVHKFIVNTLKDGR RKVVVLMDLEVMKSAEDVGLKIGNPVPYNEG - UNI15352 - - UNI18441 - GYGQQQQQ

QQQQQQQAVPSPASAATPPASKPQPQNGSLGMG - UNI15352 - GSTAAKAYGASKPFGKPAGTGLLQPSGGTQSKVVPIASLTPYQSK - UNI15

352 - KWTICARVTNKSQIRTWSNSRGEGKLFSLELVDES GEIRATAFNEQVDKFFPLIEVNK VYYFSKGALKIANKQFSAVKNDYEMTFNNETSVL

PCEDGHHLPTVQFDFTGIGDLESKAKDALVD DIIGICKSYEDSIKITVKSNNREVAKRNIYLMDMSGKVVTTTLWGED ADKFDGSRQPVMAIKGARVS

DFGGRSLSVLSSSTVIVNPDIPEAYKLRGW - UNI1158 - WFDSEGQALDGVSISDHRSGGAGGGNTNWKTLHEAKSENLGQGDK ADYFSTVAAVV

FLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDREFPNFKYRMILS ANIADFQENQWVTCFQESAEAILGQNTMYLGELKEK - UNI18262 - N

EQAFEEVFQNANFRSFTFRIRVKLETYN DESRIKATVMDVKPVDFRDYGRRLIANIRKNM

For any suggestions or comments, please send an email to unitrap@crg.es