Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000823 (Znf512b)
Chromosomal location
Chr 2: 181316808 - 181327166 (-)
Description
zinc finger protein 512B Gene [Source:MGI (curated);Acc:Znf512b-001]
UniGene
Mm.457939 Mm.386888 
MGI
MGI:2685478 
Uniprot/SPTREMBL
Q3TY00 Q6ZPW1 Q6PHP4 
Human Ortholog
ENSG00000196700 (ZNF512B)
Omim not available
UniTrap UNI26197
Vector Insertion
Chr 2: 181325564 - 181325691
Public Clones not available
Private Clones OST131067 (lexicon) OST66581 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29740
Vector Insertion
Chr 2: 181325564 - 181327167
Public Clones E088D12 (ggtc) IST14624B7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15061
Vector Insertion
Chr 2: 181325174 - 181325691
Public Clones PST13913-NL (escells) PST10083-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15052
Vector Insertion
Chr 2: 181324077 - 181325318
Public Clones PST14074-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000000840
Sequence
CGGCGCTTCCGGGCCAGGCTGCAGCCCGCGTCCGGCCTCAG - UNI15061 - - UNI26197 - - UNI29740 - AGATGACTGAATCCTTTTG

TGTTGGAGGAGGCCGTCGGCTTCAAGGATCCAGCAAAAGTGGACCTGGAAAGGGAGGCAGCCGGAAGGAGGCCCAACTTCCCTTGTTGCAGGACCCACCA

AAGCTAG - UNI15052 - - UNI15061 - - UNI26197 - - UNI29740 - GGATGCCAGTGGTCCACAGTGGACATACAGTGCCTAGCCA

GGCCCCACTCTGCTTTGACCCTGGAAACTCAGCCAGTGACAAGACAGAAGGGAAGAAAAAAGGGAGGCCGAAAGCCGAGAACCAAGCTCTCCGAGATATT

CCT - UNI15052 - - UNI15061 - CTCTCTCTGATGAACCAGTGGAAAGATGAATTCAAGGCACACTCAAGGGTGAAGTGTCCAAACTCAGGGT

GCTGGCTAGAGTTCCCCAGCATCTATGGGCTCAAGTACCACTATCAGCGGTGCCAAGGG - UNI15052 - GGTGCTATCTCAGATAGGCTGGCCTTC

CCTTGCCCCTTCTGCGAGGCCGCATTCACTTCCAAGACCCAGCTGGAGAAGCACCGGATATGGAATCACATGGACCACCCCCTACCTGCCCCCAAGCCTG

GCCCAGTCAGCCGGCCGGTCACCATCAGCCGGCCTGTTGGGGTCAGCAAGCCCATCGGAGTGAGCAAACCTGTTACTGTTGGCAAACCAGTGGGTGTCAG

CAAGCCCATTGGCATCAGTAAGCCAGTCACAGTCAGTAGGCCTATACCAGTCACCAAACCTGTCACAGTCAGTAGGCCCATGCAAGTCTCTAGGCCTGTG

CCAGTCACCAAGCCCATCCCAATTACCAAACCTGTGCCACTCACCAAACATATGCCAGTTACCAAGCTTGTGACAGTTTCAAAACCTGTGCCACTCACCA

AGCCAGTACCAGTCAGCAGGCCCATTGTGGTCAGCAAGCCTGTGCCGGTCAGCAGGCCCATCGCCATCAGCAGACACATACCACCCTGCAAAATGGTGTT

GCTGTCCAAATCTGAGAACAAAACACTTCGTGCTACAGGCAAGAACAGCAATAAGAAAAG - UNI15052 - GGCTGCAGACAGTTTGGACACCTGCC

CCATCCTGTCCAAGCAGGCAAGGCCAGAGAATGGAGCATACGGCCCATCCAGCATGGACCAGAGTGTGACCTTCCCACTGAGTACAGATCCTAGCGGCAG

CAGGCCCCTGATGGGCAAAGAGGCACTGCGGCCTATAGGCCCAGTGTCCCAGCCCGAGGAAGACCCTGAGCGCACAAAGCACA GAAGGAAACAGAAAAC

ACCGAAGAAATTCACAGGGGAGCAACCATCTATCTCAGGGACCTTTGGGCTCAAAG GCCTGGCCAAAGCTGAAGACAAGGCTCGAGTTCATCGCTCCAA

GAAGCAAGAGGGATCAGGCTCTGAGGAAGTGCGGAAGAAGGTGCTGGCCACCCCTGTCACTGTCAGCAAGGAGGCACCAACTCCTGTGGCTCACCCAGCC

CCAG GTGGCCCGGAGGAGCAGTGGCAGCGAGCCATCCATGAACGGGGGGAGGCTGTCTGCCCCACCTGCAACGTGGTTACCCGGAAGACCCTCGTGGGA

CTCAAAAAGCACATGGAAGTATGTCACAAG TTGCAGGAAGCACTCAAATGTCAGCACTGCCGAAAACAATTCAAGTCCAAGGCTGGCCTCAACTACCAC

ACCATGGCTGAACACAGTGCCAAG CCCACGGATGCTGAGGCCTCTGAAGGGGGAGAACAGGAGGAGCGGGAGAGGCTTCGAAAGGTGCTGAAGCAGATG

GGAAGGCTGCGCTGCCCCCAAGAG GGCTGTGGGGCTGCCTTCTCCAGCCTCATGGGTTATCAATACCACCAGCGGCGCTGTGGGAAGCCACCCTGTGAG

GTAGACAGTCCCTCCTTCCCCTGTACCCACTGTGGCAAGACTTACCGATCCAAGGCTGGCCACGACTATCATGTGCGTTCAGAGCACACAGCCCCG CCT

CCTGAGGATCCCACAGACAAGATCCCTGAGGCTGAGGACCTGCTTGGGGTAGAACGGACCCCAAGTGGTCGCATCCGACGTACGTCGGCCCAGGTTGCCG

TGTTCCATCTACAGGAGATTGCAGAGGATGAACTGGCCCGTGACTGGACCAAACGACGCATGAAGGATGACCTTGTGCCTGAGACTGCACGA CTCAACT

ACACTCGGCCAGGTCTCCCCACACTTAACCCTCAGCTGCTGGAAGCATGGAAGAATGAAGTCAAGGAGAAGGGCCATGTGAACTGTCCCAATGAT TGCT

GTGAAGCCATCTACGCCAGTGTGTCCGGCCTCAAGGCCCATCTTGCCAGCTGCAGCAAG GGGGACCACCTGGTGGGAAAGTACCGCTGCCTGCTGTGTC

CCAAAGAGTTCAGCTCTGAGAGCGGCGTGAAGTACCACATCCTTAAGACCCACGGAGAG AATTGGTTCCGGACCTCAGCTGACCCGTCTTCCAAACACA

AGAGCCAGGACTCCTTGATGCCTAGGAAAGAGAAGAAGAAAAGTCTGTCAGGAGGAAAGAAGCGGGGCCGCAAACCCAAGGAACGATCCTCCGAGGAGCC

AGCATCTAAGCTCCCCCCTAACAGGGATGACTGGCCCCCAGGAGGCAGAGACAGGGGGTCCCGGAGCTCCACTGGGAAGAAGGCTGGAGCTGGGAAGGCA

CCTGAAAAGTGAGCCTAGTGGGCAGGGCCTACCCATCATGCCCTGCATTGTCCAGATTAGGGGAGCCAGTTCTAGACTGGTCCTCCACCTCCAACACACA

CCCCCATCTGTCCAGAGGGTTGGCAAACTACTCTGCTCTCCCTGAAAGTGGTCCTTCCCCTGTTTAGGCTGCCTCAACAAGGCTAGATGGGGCTCCCCGG

GAGTGCCAGGGCAGCAGCAAAAGTGCAATAGGCTGGAGGACCCAGCCGTTCCTACAAGGACATTCATGGCAGGAGCCTTGGCATCATGGGGCATGAAGTG

TGCTTAAACAGTCAAATGGTCCCAGTTTCCACCTTCCTCTGGCCCAGTAGGATCCCCAATCTGACTCTTTCAAGGCTCAGACATTCCTGGTGACCCATAG

TTGTGGACTGATGAGGCACCTGAGCAGTCTGGCTGCCATAACTTGGGCCTCGCCTCCACCCAACACTGGAACTCCAGTACTCCCAGCTACCTCCCAGGAC

AGACCCTGTCTACTGCCATGCTGCCCTGACAGCCACCCACTCATCTGTCCTTTTGCATCCACCTCTGACCCCCTTGCTTCTGTTCTCTACCTCTCTGGGC

CTGCTTCCTCCTCTGTCATCCCTGTGTGCTTCAGGCCTCTCCTAACTTGACTGGCGTGATCATGGTGGAGTATGTAACCTTCCAGGCAAGGAAAGAGCTC

TGTGTGTTCTACCTTCAGGGAGGCCCAGACTAGGATGTTTCACATCCAGCCTTTAGCTTCTAATTTTGTGGTTATCGCCCTTTGGGGTGCCTCCCTGGGG

CCACAGCCATGTGAAGCAGAGGCTGGCCAGAAGGAGCCTAGCTCAGGAGTAGTACTTAGGAGAGACTGCAAATGTCTGCTATGCTAGGTGGGCCTATAAG

CCAAGTTCTGTGGAAGGCCTCTTTTTCCCTTTTATTTTATCTGCCCTTGGGATCTAGTGGCAGTCAGTCATTTGATATAGAAATGGAAGGATAGTGAAAG

ATGGGGTCTCAGCCAGTGTAGCAACTCTAGGCTGGGCCTCACCCCTTTCTTTAAGGGGCCCTGAGGCTAACAGGGTCTGCAGGTTGGACAAGGCCAGGAA

GAGACATCTGGCCTCCTTCCTGGTTCTACCTTCTAACCCTATCCCCATCTCCCAACCCTGCTGTGAGCCACACCAGGAGAAGGCTGGAGGGGGTTGGAAC

GAGCTTTTTATAGTGTTGGTAGGGGTGGACTGAGGTCTCTGCTTCTGATCCTGGATGATGTGAATTTTGATATTTGCCTCTGTGTGTCTCCTGGATGTTG

TTGATGCCAGTCTTGTTGCTGTGACAAGTAGCAACCTTTTTTTTTTCTTTTTTTTTTTTTTAATTCTGGGTTTTTTTTATACAAAACTCAACAATCTTAA

TGTCATGGTGCTAAGGGTTTCCTGGTGCCGAAGGTATTGCTGTGGTACTGACTAGCACCTGCCCCCAGCCTCAGCAGGGAGCGTTTCCAAGAAGGCCAGC

TCCAGGGAGATTTGGGGTGAGGTCCTTGTACACATGTATTTAGAAAGGCTCTGACTCTGGGCAAGGTAACCATGGCCTGGTGTGTTGTAGGTGTTGAATG

GACTCTCCAATTCCTACACACTTTGATGTGGTCAGAGGTGGCTACAGAGGTGGGTATGATCCAGTGTCAAAGGGTAGGCTGGGGCTTTGGAGTGGTTGTG

TGCAACTGTGGAAGGGAAGGGGGCCAAAGTGCACTTTTCACAACACCTCTGTGGGGTGTGACCATCCACCCTAGCCTCTCAGGTACTTGGCACTTGTAGG

GAGAAGTAGGACCTGGGTTTGCTGGGGGCTGAGTTTTCCAGGACGAACCAGAAAGCCCATATACAGCCTTGCTATGGGACTGTTCTGGGTAACTTGATGT

TAGCACTTTAACTCAGTCTTTGAGGTCAGTTTTGGGGCAGCTGTCAAAAGCTGCAGTTGGATAGGTACCAGCCTGTGGTGACTGGTAAGTAGTGGCAAAC

TAGACTGTAAAGCTCTTCCATGGTGGCAGGGCTCATCGGTCTGCCCACCTCCCTACTATGGCCCAAAGGTAACCACCAGCCTACACAGATCCTCAGTAAG

AGGGACCATCATGGCAGAGCTACAGAAGGTGGGTGGGCATAGACTTAGAGGGCCAAACCAACCCTGGGTCCTTGGCAAAATGCAAAAGTCAGGGTCTCTA

CAGATCTACCTCTGGCTCAGCGCTTGCCCTGCCCTAAAAAAACAGAAGTGCCAAGGGCAGACATTTCATGCAGAACCAGGGTGCACTTTATGTTCCTGCA

CAGGCAGATGATGGTGCCTCCTGGAGGCTTTGGGATCTTCCTGTCCCTATGGTGGTTCTGAAGGGAGAGCTGTTCCCCTGTTGGGTGAAACCCAGGTCCC

TTGCCCTGGAGACCTGGTTTCCCAGGTCACCCCACATACCTGACTGCAGCGCCTCCTAAACTTTGGGTTCCTTGGTTTGGTTATAATGCAGTTCTCATTA

CACAAGTGCATTTCTGGCTATCACTTGTAACCATAGATATACATGCATATATATTCTATCTACAAAGTGTTTTATTTGCAAGATGTTTTGAGGTGAGCTT

TGGTCCTGCCCGCCTTGTGGTCATCTGTCCTCATCCTCATCCCCTGGCCCGGAGTGGTGCGGTGGTGGGCCATCAACTATGTATTAAAGTCACTGTATC
Translation
GASGPGCSPRPASE - UNI15061 - - UNI26197 - - UNI29740 - EMTESFCVGGGRRLQGSSKSGPGKGGSRKEAQLPLLQDPPKLG - 

UNI15052 - - UNI15061 - - UNI26197 - - UNI29740 - GMPVVHSGHTVPSQAPLCFDPGNSASDKTEGKKKGRPKAENQALRDIP -

 UNI15052 - - UNI15061 - LSLMNQWKDEFKAHSRVKCPNSGCWLEFPSIYGLKYHYQRCQG - UNI15052 - GAISDRLAFPCPFCEAAF

TSKTQLEKHRIWNHMDHPLPAPKPGPVSRPVTISRPVGVSKPIGVSKPVTVGKPVGVSKPIGISKPVTVSRPIPVTKPVTVSRPMQVSRPVPVTKPIPIT

KPVPLTKHMPVTKLVTVSKPVPLTKPVPVSRPIVVSKPVPVSRPIAISRHIPPCKMVLLSKSENKTLRATGKNSNKKR - UNI15052 - RAADSLDT

CPILSKQARPENGAYGPSSMDQSVTFPLSTDPSGSRPLMGKEALRPIGPVSQPEEDPERTKHR RRKQKTPKKFTGEQPSISGTFGLKG GLAKAEDKAR

VHRSKKQEGSGSEEVRKKVLATPVTVSKEAPTPVAHPAPG GGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCHK LQEALKCQHCRKQFKS

KAGLNYHTMAEHSAK PTDAEASEGGEQEERERLRKVLKQMGRLRCPQE GCGAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCTHCGKTYRSKAGHDYHV

RSEHTAP PPEDPTDKIPEAEDLLGVERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETAR LNYTRPGLPTLNPQLLEAWKNEVKEK

GHVNCPND CCEAIYASVSGLKAHLASCSK GDHLVGKYRCLLCPKEFSSESGVKYHILKTHGE NWFRTSADPSSKHKSQDSLMPRKEKKKSLSGGKKR

GRKPKERSSEEPASKLPPNRDDWPPGGRDRGSRSSTGKKAGAGKAPEK
Transcript ENSMUST00000108791
Sequence
CGGCGCTTCCGGGCCAGGCTGCAGCCCGCGTCCGGCCTCAG - UNI15061 - - UNI26197 - - UNI29740 - AGATGACTGAATCCTTTTG

TGTTGGAGGAGGCCGTCGGCTTCAAGGATCCAGCAAAAGTGGACCTGGAAAGGGAGGCAGCCGGAAGGAGGCCCAACTTCCCTTGTTGCAGGACCCACCA

AAGCTAG - UNI15052 - - UNI15061 - - UNI26197 - - UNI29740 - GGATGCCAGTGGTCCACAGTGGACATACAGTGCCTAGCCA

GGCCCCACTCTGCTTTGACCCTGGAAACTCAGCCAGTGACAAGACAGAAGGGAAGAAAAAAGGGAGGCCGAAAGCCGAGAACCAAGCTCTCCGAGATATT

CCT - UNI15052 - - UNI15061 - CTCTCTCTGATGAACCAGTGGAAAGATGAATTCAAGGCACACTCAAGGGTGAAGTGTCCAAACTCAGGGT

GCTGGCTAGAGTTCCCCAGCATCTATGGGCTCAAGTACCACTATCAGCGGTGCCAAGGGGTAAGGGGCTGTGGGCCAGGGAAGAGGAGGCCTGGGGGTGC

ATCTGGGCAGAGGCCCCCGGGGCCCCATCCCACACCTGCCCTCCCTGCCCAGGGTGCTATCTCAGATAGGCTGGCCTTCCCTTGCCCCTTCTGCGAGGCC

GCATTCACTTCCAAGACCCAGCTGGAGAAGCACCGGATATGGAATCACATGGACCACCCCCTACCTGCCCCCAAGCCTGGCCCAGTCAGCCGGCCGGTCA

CCATCAGCCGGCCTGTTGGGGTCAGCAAGCCCATCGGAGTGAGCAAACCTGTTACTGTTGGCAAACCAGTGGGTGTCAGCAAGCCCATTGGCATCAGTAA

GCCAGTCACAGTCAGTAGGCCTATACCAGTCACCAAACCTGTCACAGTCAGTAGGCCCATGCAAGTCTCTAGGCCTGTGCCAGTCACCAAGCCCATCCCA

ATTACCAAACCTGTGCCACTCACCAAACATATGCCAGTTACCAAGCTTGTGACAGTTTCAAAACCTGTGCCACTCACCAAGCCAGTACCAGTCAGCAGGC

CCATTGTGGTCAGCAAGCCTGTGCCGGTCAGCAGGCCCATCGCCATCAGCAGACACATACCACCCTGCAAAATGGTGTTGCTGTCCAAATCTGAGAACAA

AACACTTCGTGCTACAGGCAAGAACAGCAATAAGAAAAG - UNI15052 - GGCTGCAGACAGTTTGGACACCTGCCCCATCCTGTCCAAGCAGGCAA

GGCCAGAGAATGGAGCATACGGCCCATCCAGCATGGACCAGAGTGTGACCTTCCCACTGAGTACAGATCCTAGCGGCAGCAGGCCCCTGATGGGCAAAGA

GGCACTGCGGCCTATAGGCCCAGTGTCCCAGCCCGAGGAAGACCCTGAGCGCACAAAGCACA GAAGGAAACAGAAAACACCGAAGAAATTCACAGGGGA

GCAACCATCTATCTCAGGGACCTTTGGGCTCAAAG GCCTGGCCAAAGCTGAAGACAAGGCTCGAGTTCATCGCTCCAAGAAGCAAGAGGGATCAGGCTC

TGAGGAAGTGCGGAAGAAGGTGCTGGCCACCCCTGTCACTGTCAGCAAGGAGGCACCAACTCCTGTGGCTCACCCAGCCCCAG GTGGCCCGGAGGAGCA

GTGGCAGCGAGCCATCCATGAACGGGGGGAGGCTGTCTGCCCCACCTGCAACGTGGTTACCCGGAAGACCCTCGTGGGACTCAAAAAGCACATGGAAGTA

TGTCACAAG TTGCAGGAAGCACTCAAATGTCAGCACTGCCGAAAACAATTCAAGTCCAAGGCTGGCCTCAACTACCACACCATGGCTGAACACAGTGCC

AAG CCCACGGATGCTGAGGCCTCTGAAGGGGGAGAACAGGAGGAGCGGGAGAGGCTTCGAAAGGTGCTGAAGCAGATGGGAAGGCTGCGCTGCCCCCAA

GAG GGCTGTGGGGCTGCCTTCTCCAGCCTCATGGGTTATCAATACCACCAGCGGCGCTGTGGGAAGCCACCCTGTGAGGTAGACAGTCCCTCCTTCCCC

TGTACCCACTGTGGCAAGACTTACCGATCCAAGGCTGGCCACGACTATCATGTGCGTTCAGAGCACACAGCCCCG CCTCCTGAGGATCCCACAGACAAG

ATCCCTGAGGCTGAGGACCTGCTTGGGGTAGAACGGACCCCAAGTGGTCGCATCCGACGTACGTCGGCCCAGGTTGCCGTGTTCCATCTACAGGAGATTG

CAGAGGATGAACTGGCCCGTGACTGGACCAAACGACGCATGAAGGATGACCTTGTGCCTGAGACTGCACGA CTCAACTACACTCGGCCAGGTCTCCCCA

CACTTAACCCTCAGCTGCTGGAAGCATGGAAGAATGAAGTCAAGGAGAAGGGCCATGTGAACTGTCCCAATGAT TGCTGTGAAGCCATCTACGCCAGTG

TGTCCGGCCTCAAGGCCCATCTTGCCAGCTGCAGCAAG GGGGACCACCTGGTGGGAAAGTACCGCTGCCTGCTGTGTCCCAAAGAGTTCAGCTCTGAGA

GCGGCGTGAAGTACCACATCCTTAAGACCCACGGAGAG AATTGGTTCCGGACCTCAGCTGACCCGTCTTCCAAACACAAGAGCCAGGACTCCTTGATGC

CTAGGAAAGAGAAGAAGAAAAGTCTGTCAGGAGGAAAGAAGCGGGGCCGCAAACCCAAGGAACGATCCTCCGAGGAGCCAGCATCTAAGCTCCCCCCTAA

CAGGGATGACTGGCCCCCAGGAGGCAGAGACAGGGGGTCCCGGAGCTCCACTGGGAAGAAGGCTGGAGCTGGGAAGGCACCTGAAAAGTGAGCCTAGTGG

GCAGGGCCTACCCATCATGCCCTGCATTGTCCAGATTAGGGGAGCCAGTTCTAGACTGGTCCTCCACCTCCAACACACACCCCCATCTGTCCAGAGGGTT

GGCAAACTACTCTGCTCTCCCTGAAAGTGGTCCTTCCCCTGTTTAGGCTGCCTCAACAAGGCTAGATGGGGCTCCCCGGGAGTGCCAGGGCAGCAGCAAA

AGTGCAATAGGCTGGAGGACCCAGCCGTTCCTACAAGGACATTCATGGCAGGAGCCTTGGCATCATGGGGCATGAAGTGTGCTTAAACAGTCAAATGGTC

CCAGTTTCCACCTTCCTCTGGCCCAGTAGGATCCCCAATCTGACTCTTTCAAGGCTCAGACATTCCTGGTGACCCATAGTTGTGGACTGATGAGGCACCT

GAGCAGTCTGGCTGCCATAACTTGGGCCTCGCCTCCACCCAACACTGGAACTCCAGTACTCCCAGCTACCTCCCAGGACAGACCCTGTCTACTGCCATGC

TGCCCTGACAGCCACCCACTCATCTGTCCTTTTGCATCCACCTCTGACCCCCTTGCTTCTGTTCTCTACCTCTCTGGGCCTGCTTCCTCCTCTGTCATCC

CTGTGTGCTTCAGGCCTCTCCTAACTTGACTGGCGTGATCATGGTGGAGTATGTAACCTTCCAGGCAAGGAAAGAGCTCTGTGTGTTCTACCTTCAGGGA

GGCCCAGACTAGGATGTTTCACATCCAGCCTTTAGCTTCTAATTTTGTGGTTATCGCCCTTTGGGGTGCCTCCCTGGGGCCACAGCCATGTGAAGCAGAG

GCTGGCCAGAAGGAGCCTAGCTCAGGAGTAGTACTTAGGAGAGACTGCAAATGTCTGCTATGCTAGGTGGGCCTATAAGCCAAGTTCTGTGGAAGGCCTC

TTTTTCCCTTTTATTTTATCTGCCCTTGGGATCTAGTGGCAGTCAGTCATTTGATATAGAAATGGAAGGATAGTGAAAGATGGGGTCTCAGCCAGTGTAG

CAACTCTAGGCTGGGCCTCACCCCTTTCTTTAAGGGGCCCTGAGGCTAACAGGGTCTGCAGGTTGGACAAGGCCAGGAAGAGACATCTGGCCTCCTTCCT

GGTTCTACCTTCTAACCCTATCCCCATCTCCCAACCCTGCTGTGAGCCACACCAGGAGAAGGCTGGAGGGGGTTGGAACGAGCTTTTTATAGTGTTGGTA

GGGGTGGACTGAGGTCTCTGCTTCTGATCCTGGATGATGTGAATTTTGATATTTGCCTCTGTGTGTCTCCTGGATGTTGTTGATGCCAGTCTTGTTGCTG

TGACAAGTAGCAACCTTTTTTTTTTCTTTTTTTTTTTTTTAATTCTGGGTTTTTTTTATACAAAACTCAACAATCTTAATGTCATGGTGCTAAGGGTTTC

CTGGTGCCGAAGGTATTGCTGTGGTACTGACTAGCACCTGCCCCCAGCCTCAGCAGGGAGCGTTTCCAAGAAGGCCAGCTCCAGGGAGATTTGGGGTGAG

GTCCTTGTACACATGTATTTAGAAAGGCTCTGACTCTGGGCAAGGTAACCATGGCCTGGTGTGTTGTAGGTGTTGAATGGACTCTCCAATTCCTACACAC

TTTGATGTGGTCAGAGGTGGCTACAGAGGTGGGTATGATCCAGTGTCAAAGGGTAGGCTGGGGCTTTGGAGTGGTTGTGTGCAACTGTGGAAGGGAAGGG

GGCCAAAGTGCACTTTTCACAACACCTCTGTGGGGTGTGACCATCCACCCTAGCCTCTCAGGTACTTGGCACTTGTAGGGAGAAGTAGGACCTGGGTTTG

CTGGGGGCTGAGTTTTCCAGGACGAACCAGAAAGCCCATATACAGCCTTGCTATGGGACTGTTCTGGGTAACTTGATGTTAGCACTTTAACTCAGTCTTT

GAGGTCAGTTTTGGGGCAGCTGTCAAAAGCTGCAGTTGGATAGGTACCAGCCTGTGGTGACTGGTAAGTAGTGGCAAACTAGACTGTAAAGCTCTTCCAT

GGTGGCAGGGCTCATCGGTCTGCCCACCTCCCTACTATGGCCCAAAGGTAACCACCAGCCTACACAGATCCTCAGTAAGAGGGACCATCATGGCAGAGCT

ACAGAAGGTGGGTGGGCATAGACTTAGAGGGCCAAACCAACCCTGGGTCCTTGGCAAAATGCAAAAGTCAGGGTCTCTACAGATCTACCTCTGGCTCAGC

GCTTGCCCTGCCCTAAAAAAACAGAAGTGCCAAGGGCAGACATTTCATGCAGAACCAGGGTGCACTTTATGTTCCTGCACAGGCAGATGATGGTGCCTCC

TGGAGGCTTTGGGATCTTCCTGTCCCTATGGTGGTTCTGAAGGGAGAGCTGTTCCCCTGTTGGGTGAAACCCAGGTCCCTTGCCCTGGAGACCTGGTTTC

CCAGGTCACCCCACATACCTGACTGCAGCGCCTCCTAAACTTTGGGTTCCTTGGTTTGGTTATAATGCAGTTCTCATTACACAAGTGCATTTCTGGCTAT

CACTTGTAACCATAGATATACATGCATATATATTCTATCTACAAAGTGTTTTATTTGCAAGATGTTTTGAGGTGAGCTTTGGTCCTGCCCGCCTTGTGGT

CATCTGTCCTCATCCTCATCCCCTGGCCCGGAGTGGTGCGGTGGTGGGCCATCAACTATGTATTAAAGTCACTGTATC
Translation
 - UNI15061 - - UNI26197 - - UNI29740 - MTESFCVGGGRRLQGSSKSGPGKGGSRKEAQLPLLQDPPKLG - UNI15052 - - UN

I15061 - - UNI26197 - - UNI29740 - GMPVVHSGHTVPSQAPLCFDPGNSASDKTEGKKKGRPKAENQALRDIP - UNI15052 - - U

NI15061 - LSLMNQWKDEFKAHSRVKCPNSGCWLEFPSIYGLKYHYQRCQGVRGCGPGKRRPGGASGQRPPGPHPTPALPAQGAISDRLAFPCPFCEA

AFTSKTQLEKHRIWNHMDHPLPAPKPGPVSRPVTISRPVGVSKPIGVSKPVTVGKPVGVSKPIGISKPVTVSRPIPVTKPVTVSRPMQVSRPVPVTKPIP

ITKPVPLTKHMPVTKLVTVSKPVPLTKPVPVSRPIVVSKPVPVSRPIAISRHIPPCKMVLLSKSENKTLRATGKNSNKKR - UNI15052 - RAADSL

DTCPILSKQARPENGAYGPSSMDQSVTFPLSTDPSGSRPLMGKEALRPIGPVSQPEEDPERTKHR RRKQKTPKKFTGEQPSISGTFGLKG GLAKAEDK

ARVHRSKKQEGSGSEEVRKKVLATPVTVSKEAPTPVAHPAPG GGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCHK LQEALKCQHCRKQF

KSKAGLNYHTMAEHSAK PTDAEASEGGEQEERERLRKVLKQMGRLRCPQE GCGAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCTHCGKTYRSKAGHDY

HVRSEHTAP PPEDPTDKIPEAEDLLGVERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETAR LNYTRPGLPTLNPQLLEAWKNEVK

EKGHVNCPND CCEAIYASVSGLKAHLASCSK GDHLVGKYRCLLCPKEFSSESGVKYHILKTHGE NWFRTSADPSSKHKSQDSLMPRKEKKKSLSGGK

KRGRKPKERSSEEPASKLPPNRDDWPPGGRDRGSRSSTGKKAGAGKAPEK
Transcript ENSMUST00000108789
Sequence
CGGCGCTTCCGGGCCAGGCTGCAGCCCGCGTCCGGCCTCAG - UNI15061 - - UNI26197 - - UNI29740 - AGATGACTGAATCCTTTTG

TGTTGGAGGAGGCCGTCGGCTTCAAGGATCCAGCAAAAGTGGACCTGGAAAGGGAGGCAGCCGGAAGGAGGCCCAACTTCCCTTGTTGCAGGACCCACCA

AAGCTAG - UNI15052 - - UNI15061 - - UNI26197 - - UNI29740 - GGATGCCAGTGGTCCACAGTGGACATACAGTGCCTAGCCA

GGCCCCACTCTGCTTTGACCCTGGAAACTCAGCCAGTGACAAGACAGAAGGGAAGAAAAAAGGGAGGCCGAAAGCCGAGAACCAAGCTCTCCGAGATATT

CCT - UNI15052 - - UNI15061 - CTCTCTCTGATGAACCAGTGGAAAGATGAATTCAAGGCACACTCAAGGGTGAAGTGTCCAAACTCAGGGT

GCTGGCTAGAGTTCCCCAGCATCTATGGGCTCAAGTACCACTATCAGCGGTGCCAAGGG - UNI15052 - GGTGCTATCTCAGATAGGCTGGCCTTC

CCTTGCCCCTTCTGCGAGGCCGCATTCACTTCCAAGACCCAGCTGGAGAAGCACCGGATATGGAATCACATGGACCACCCCCTACCTGCCCCCAAGCCTG

GCCCAGTCAGCCGGCCGGTCACCATCAGCCGGCCTGTTGGGGTCAGCAAGCCCATCGGAGTGAGCAAACCTGTTACTGTTGGCAAACCAGTGGGTGTCAG

CAAGCCCATTGGCATCAGTAAGCCAGTCACAGTCAGTAGGCCTATACCAGTCACCAAACCTGTCACAGTCAGTAGGCCCATGCAAGTCTCTAGGCCTGTG

CCAGTCACCAAGCCCATCCCAATTACCAAACCTGTGCCACTCACCAAACATATGCCAGTTACCAAGCTTGTGACAGTTTCAAAACCTGTGCCACTCACCA

AGCCAGTACCAGTCAGCAGGCCCATTGTGGTCAGCAAGCCTGTGCCGGTCAGCAGGCCCATCGCCATCAGCAGACACATACCACCCTGCAAAATGGTGTT

GCTGTCCAAATCTGAGAACAAAACACTTCGTGCTACAGGCAAGAACAGCAATAAGAAAAG - UNI15052 - GGCTGCAGACAGTTTGGACACCTGCC

CCATCCTGTCCAAGCAGGCAAGGCCAGAGAATGGAGCATACGGCCCATCCAGCATGGACCAGAGTGTGACCTTCCCACTGAGTACAGATCCTAGCGGCAG

CAGGCCCCTGATGGGCAAAGAGGCACTGCGGCCTATAGGCCCAGTGTCCCAGCCCGAGGAAGACCCTGAGCGCACAAAGCACA GAAGGAAACAGAAAAC

ACCGAAGAAATTCACAGGGGAGCAACCATCTATCTCAGGGACCTTTGGGCTCAAAG GCCTGGCCAAAGCTGAAGACAAGGCTCGAGTTCATCGCTCCAA

GAAGCAAGAGGGATCAGGCTCTGAGGAAGTGCGGAAGAAGGTGCTGGCCACCCCTGTCACTGTCAGCAAGGAGGCACCAACTCCTGTGGCTCACCCAGCC

CCAG GTGGCCCGGAGGAGCAGTGGCAGCGAGCCATCCATGAACGGGGGGAGGCTGTCTGCCCCACCTGCAACGTGGTTACCCGGAAGACCCTCGTGGGA

CTCAAAAAGCACATGGAAGTATGTCACAAG TTGCAGGAAGCACTCAAATGTCAGCACTGCCGAAAACAATTCAAGTCCAAGGCTGGCCTCAACTACCAC

ACCATGGCTGAACACAGTGCCAAG CCCACGGATGCTGAGGCCTCTGAAGGGGGAGAACAGGAGGAGCGGGAGAGGCTTCGAAAGGTGCTGAAGCAGATG

GGAAGGCTGCGCTGCCCCCAAGAG GGCTGTGGGGCTGCCTTCTCCAGCCTCATGGGTTATCAATACCACCAGCGGCGCTGTGGGAAGCCACCCTGTGAG

GTAGACAGTCCCTCCTTCCCCTGTACCCACTGTGGCAAGACTTACCGATCCAAGGCTGGCCACGACTATCATGTGCGTTCAGAGCACACAGCCCCG CCT

CCTGAGGATCCCACAGACAAGATCCCTGAGGCTGAGGACCTGCTTGGGGTAGAACGGACCCCAAGTGGTCGCATCCGACGTACGTCGGCCCAGGTTGCCG

TGTTCCATCTACAGGAGATTGCAGAGGATGAACTGGCCCGTGACTGGACCAAACGACGCATGAAGGATGACCTTGTGCCTGAGACTGCACGA CTCAACT

ACACTCGGCCAGGTCTCCCCACACTTAACCCTCAGCTGCTGGAAGCATGGAAGAATGAAGTCAAGGAGAAGGGCCATGTGAACTGTCCCAATGAT TGCT

GTGAAGCCATCTACGCCAGTGTGTCCGGCCTCAAGGCCCATCTTGCCAGCTGCAGCAAG GGGGACCACCTGGTGGGAAAGTACCGCTGCCTGCTGTGTC

CCAAAGAGTTCAGCTCTGAGAGCGGCGTGAAGTACCACATCCTTAAGACCCACGGAGAG AATTGGTTCCGGACCTCAGCTGACCCGTCTTCCAAACACA

AGAGCCAGGACTCCTTGATGCCTAGGAAAGAGAAGAAGAAAAGTCTGTCAGGAGGAAAGAAGCGGGGCCGCAAACCCAAGGAACGATCCTCCGAGGAGCC

AGCATCTAAGCTCCCCCCTAACAGGGATGACTGGCCCCCAGGAGGCAGAGACAGGGGGTCCCGGAGCTCCACTGGGAAGAAGGCTGGAGCTGGGAAGGCA

CCTGAAAAGTGAGCCTAGTGGGCAGGGCCTACCCATCATGCCCTGCATTGTCCAGATTAGGGGAGCCAGTTCTAGACTGGTCCTCCACCTCCAACACACA

CCCCCATCTGTCCAGAGGGTTGGCAAACTACTCTGCTCTCCCTGAAAGTGGTCCTTCCCCTGTTTAGGCTGCCTCAACAAGGCTAGATGGGGCTCCCCGG

GAGTGCCAGGGCAGCAGCAAAAGTGCAATAGGCTGGAGGACCCAGCCGTTCCTACAAGGACATTCATGGCAGGAGCCTTGGCATCATGGGGCATGAAGTG

TGCTTAAACAGTCAAATGGTCCCAGTTTCCACCTTCCTCTGGCCCAGTAGGATCCCCAATCTGACTCTTTCAAGGCTCAGACATTCCTGGTGACCCATAG

TTGTGGACTGATGAGGCACCTGAGCAGTCTGGCTGCCATAACTTGGGCCTCGCCTCCACCCAACACTGGAACTCCAGTACTCCCAGCTACCTCCCAGGAC

AGACCCTGTCTACTGCCATGCTGCCCTGACAGCCACCCACTCATCTGTCCTTTTGCATCCACCTCTGACCCCCTTGCTTCTGTTCTCTACCTCTCTGGGC

CTGCTTCCTCCTCTGTCATCCCTGTGTGCTTCAGGCCTCTCCTAACTTGACTGGCGTGATCATGGTGGAGTATGTAACCTTCCAGGCAAGGAAAGAGCTC

TGTGTGTTCTACCTTCAGGGAGGCCCAGACTAGGATGTTTCACATCCAGCCTTTAGCTTCTAATTTTGTGGTTATCGCCCTTTGGGGTGCCTCCCTGGGG

CCACAGCCATGTGAAGCAGAGGCTGGCCAGAAGGAGCCTAGCTCAGGAGTAGTACTTAGGAGAGACTGCAAATGTCTGCTATGCTAGGTGGGCCTATAAG

CCAAGTTCTGTGGAAGGCCTCTTTTTCCCTTTTATTTTATCTGCCCTTGGGATCTAGTGGCAGTCAGTCATTTGATATAGAAATGGAAGGATAGTGAAAG

ATGGGGTCTCAGCCAGTGTAGCAACTCTAGGCTGGGCCTCACCCCTTTCTTTAAGGGGCCCTGAGGCTAACAGGGTCTGCAGGTTGGACAAGGCCAGGAA

GAGACATCTGGCCTCCTTCCTGGTTCTACCTTCTAACCCTATCCCCATCTCCCAACCCTGCTGTGAGCCACACCAGGAGAAGGCTGGAGGGGGTTGGAAC

GAGCTTTTTATAGTGTTGGTAGGGGTGGACTGAGGTCTCTGCTTCTGATCCTGGATGATGTGAATTTTGATATTTGCCTCTGTGTGTCTCCTGGATGTTG

TTGATGCCAGTCTTGTTGCTGTGACAAGTAGCAACCTTTTTTTTTTCTTTTTTTTTTTTTTAATTCTGGGTTTTTTTTATACAAAACTCAACAATCTTAA

TGTCATGGTGCTAAGGGTTTCCTGGTGCCGAAGGTATTGCTGTGGTACTGACTAGCACCTGCCCCCAGCCTCAGCAGGGAGCGTTTCCAAGAAGGCCAGC

TCCAGGGAGATTTGGGGTGAGGTCCTTGTACACATGTATTTAGAAAGGCTCTGACTCTGGGCAAGGTAACCATGGCCTGGTGTGTTGTAGGTGTTGAATG

GACTCTCCAATTCCTACACACTTTGATGTGGTCAGAGGTGGCTACAGAGGTGGGTATGATCCAGTGTCAAAGGGTAGGCTGGGGCTTTGGAGTGGTTGTG

TGCAACTGTGGAAGGGAAGGGGGCCAAAGTGCACTTTTCACAACACCTCTGTGGGGTGTGACCATCCACCCTAGCCTCTCAGGTACTTGGCACTTGTAGG

GAGAAGTAGGACCTGGGTTTGCTGGGGGCTGAGTTTTCCAGGACGAACCAGAAAGCCCATATACAGCCTTGCTATGGGACTGTTCTGGGTAACTTGATGT

TAGCACTTTAACTCAGTCTTTGAGGTCAGTTTTGGGGCAGCTGTCAAAAGCTGCAGTTGGATAGGTACCAGCCTGTGGTGACTGGTAAGTAGTGGCAAAC

TAGACTGTAAAGCTCTTCCATGGTGGCAGGGCTCATCGGTCTGCCCACCTCCCTACTATGGCCCAAAGGTAACCACCAGCCTACACAGATCCTCAGTAAG

AGGGACCATCATGGCAGAGCTACAGAAGGTGGGTGGGCATAGACTTAGAGGGCCAAACCAACCCTGGGTCCTTGGCAAAATGCAAAAGTCAGGGTCTCTA

CAGATCTACCTCTGGCTCAGCGCTTGCCCTGCCCTAAAAAAACAGAAGTGCCAAGGGCAGACATTTCATGCAGAACCAGGGTGCACTTTATGTTCCTGCA

CAGGCAGATGATGGTGCCTCCTGGAGGCTTTGGGATCTTCCTGTCCCTATGGTGGTTCTGAAGGGAGAGCTGTTCCCCTGTTGGGTGAAACCCAGGTCCC

TTGCCCTGGAGACCTGGTTTCCCAGGTCACCCCACATACCTGACTGCAGCGCCTCCTAAACTTTGGGTTCCTTGGTTTGGTTATAATGCAGTTCTCATTA

CACAAGTGCATTTCTGGCTATCACTTGTAACCATAGATATACATGCATATATATTCTATCTACAAAGTGTTTTATTTGCAAGATGTTTTGAGGTGAGCTT

TGGTCCTGCCCGCCTTGTGGTCATCTGTCCTCATCCTCATCCCCTGGCCCGGAGTGGTGCGGTGGTGGGCCATCAACTATGTATTAAAGTCACTGTATCA

AATAAATGTTTATTGATTTTTTTTTTCCAGG
Translation
 - UNI15061 - - UNI26197 - - UNI29740 - MTESFCVGGGRRLQGSSKSGPGKGGSRKEAQLPLLQDPPKLG - UNI15052 - - UN

I15061 - - UNI26197 - - UNI29740 - GMPVVHSGHTVPSQAPLCFDPGNSASDKTEGKKKGRPKAENQALRDIP - UNI15052 - - U

NI15061 - LSLMNQWKDEFKAHSRVKCPNSGCWLEFPSIYGLKYHYQRCQG - UNI15052 - GAISDRLAFPCPFCEAAFTSKTQLEKHRIWNHM

DHPLPAPKPGPVSRPVTISRPVGVSKPIGVSKPVTVGKPVGVSKPIGISKPVTVSRPIPVTKPVTVSRPMQVSRPVPVTKPIPITKPVPLTKHMPVTKLV

TVSKPVPLTKPVPVSRPIVVSKPVPVSRPIAISRHIPPCKMVLLSKSENKTLRATGKNSNKKR - UNI15052 - RAADSLDTCPILSKQARPENGAY

GPSSMDQSVTFPLSTDPSGSRPLMGKEALRPIGPVSQPEEDPERTKHR RRKQKTPKKFTGEQPSISGTFGLKG GLAKAEDKARVHRSKKQEGSGSEEV

RKKVLATPVTVSKEAPTPVAHPAPG GGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCHK LQEALKCQHCRKQFKSKAGLNYHTMAEHSAK

 PTDAEASEGGEQEERERLRKVLKQMGRLRCPQE GCGAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCTHCGKTYRSKAGHDYHVRSEHTAP PPEDPTD

KIPEAEDLLGVERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETAR LNYTRPGLPTLNPQLLEAWKNEVKEKGHVNCPND CCEAIY

ASVSGLKAHLASCSK GDHLVGKYRCLLCPKEFSSESGVKYHILKTHGE NWFRTSADPSSKHKSQDSLMPRKEKKKSLSGGKKRGRKPKERSSEEPASK

LPPNRDDWPPGGRDRGSRSSTGKKAGAGKAPEK

For any suggestions or comments, please send an email to unitrap@crg.es