Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000826 (Dnajc5)
Chromosomal location
Chr 2: 181255210 - 181286938 (+)
Description
DnaJ (Hsp40) homolog, subfamily C, member 5 Gene [Source:MGI (curated);Acc:Dnajc5-001]
RefSeq_dna
NM_016775 
RefSeq_peptide
NP_058055.1 
UniGene
Mm.140761 Mm.408042 Mm.408969 
MGI
MGI:892995 
Uniprot/SWISSPROT
P60904 
Uniprot/SPTREMBL
A2AUE1 Q921J3 A2AUE2 
Human Ortholog
ENSG00000101152 (DNAJC5)
Omim not available
UniTrap UNI7481
Vector Insertion
Chr 2: 181255255 - 181255403
Public Clones RRR815 (baygenomics) Ayu21-T309 (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29488
Vector Insertion
Chr 2: 181255764 - 181255939
Public Clones P140D04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29866
Vector Insertion
Chr 2: 181255993 - 181281075
Public Clones (sanger) E041G02 (ggtc) IST13682C8 (tigm) IST10088B2 (tigm) IST13682E9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17392
Vector Insertion
Chr 2: 181281075 - 181281194
Public Clones not available
Private Clones OST443568 (lexicon) OST434576 (lexicon) OST420634 (lexicon) OST377635 (lexicon)
OST333995 (lexicon) OST302884 (lexicon) OST274854 (lexicon) OST206467 (lexicon)
OST161487 (lexicon) OST126586 (lexicon) OST95921 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23044
Vector Insertion
Chr 2: 181281194 - 181282044
Public Clones not available
Private Clones OST278335 (lexicon) OST248915 (lexicon) OST239335 (lexicon) OST236377 (lexicon)
OST192553 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25389
Vector Insertion
Chr 2: 181282259 - 181283374
Public Clones not available
Private Clones OST185705 (lexicon) OST185355 (lexicon)
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108798
Sequence
GGGGCGCGCGTGCCAGTGAGTGAGCGTGCGCGTTCTTGCTGCCGCCAGTGTTGCTTCCGCCGTCCTCTGCCGCTGCTACGGCTGTCGCCGCCCGGGATCC

TCAGGCCGAGCAGTAGGCCGGCCGGCTGCCCACCACTGCCCCGGGACGGAAAGCGGAGCCGCGGAACCGGTGGACCGGCGGGCGTGCCGACAG - UNI7

481 - - UNI17392 - - UNI29488 - - UNI29866 - ACTAACCTAACATGGCCGACCAGAGGCAGCGCTCACTCTCTACTTCCGGGGAATC

ATTATACCATGTTCTTGGACTGGACAAGAATGCAACCTCAGATGACATTAAAAAGTCCTATCG - UNI17392 - - UNI23044 - GAAGCTGGCC

CTGAAGTATCACCCTGACAAGAACCCTGATAACCCAGAGGCTGCAGACAAGTTTAAGGAGATTAACAACGCACACGCCATCCTGACAGACGCCACGAAAA

GAAACATTTATGACAAGTATGGCTCGCTGGGGCTCTATGTGGCGGAGCAGTTTGGGGAGGAGAACGTCAACACCTACTTCGTACTCTCCAGCTGGTGGGC

CAAG - UNI25389 - GCGCTGTTTGTTGTTTGTGGCCTCCTCACCTGCTGCTACTGCTGCTGCTGTTTGTGCTGTTGCTTTAACTGCTGCTGTGGGA

AATGCAAGCCCAAGGCACCTGAGGGTGAGGAGACAGAATTCTACGTATCCCCTGAAGACTTGGAGGCACAGCTGCAGTCTGATGAAAGGG AGGCTACAG

ACACACCGATCGTCATACAGCCAGCATCTGCCACAGAGACCACCCAGCTGACAGCTGACTCCCACCCCAGCTATCACACCGACGGGTTCAA GAAGTTAC

AAGAAGAGGCA
Translation
 - UNI7481 - - UNI17392 - - UNI29488 - - UNI29866 - MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYR - UNI17392 

- - UNI23044 - RKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAK - UNI25389 -

 ALFVVCGLLTCCYCCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDERE EATDTPIVIQPASATETTQLTADSHPSYHTDGFK KKLQE

EA
Transcript ENSMUST00000072334
Sequence
GGGGCGCGCGTGCCAGTGAGTGAGCGTGCGCGTTCTTGCTGCCGCCAGTGTTGCTTCCGCCGTCCTCTGCCGCTGCTACGGCTGTCGCCGCCCGGGATCC

TCAGGCCGAGCAGTAGGCCGGCCGGCTGCCCACCACTGCCCCGGGACGGAAAGCGGAGCCGCGGAACCGGTGGACCGGCGGGCGTGCCGACAG - UNI7

481 - - UNI17392 - - UNI29488 - - UNI29866 - ACTAACCTAACATGGCCGACCAGAGGCAGCGCTCACTCTCTACTTCCGGGGAATC

ATTATACCATGTTCTTGGACTGGACAAGAATGCAACCTCAGATGACATTAAAAAGTCCTATCG - UNI17392 - - UNI23044 - GAAGCTGGCC

CTGAAGTATCACCCTGACAAGAACCCTGATAACCCAGAGGCTGCAGACAAGTTTAAGGAGATTAACAACGCACACGCCATCCTGACAGACGCCACGAAAA

GAAACATTTATGACAAGTATGGCTCGCTGGGGCTCTATGTGGCGGAGCAGTTTGGGGAGGAGAACGTCAACACCTACTTCGTACTCTCCAGCTGGTGGGC

CAAG - UNI25389 - GCGCTGTTTGTTGTTTGTGGCCTCCTCACCTGCTGCTACTGCTGCTGCTGTTTGTGCTGTTGCTTTAACTGCTGCTGTGGGA

AATGCAAGCCCAAGGCACCTGAGGGTGAGGAGACAGAATTCTACGTATCCCCTGAAGACTTGGAGGCACAGCTGCAGTCTGATGAAAGGG AGGCTACAG

ACACACCGATCGTCATACAGCCAGCATCTGCCACAGAGACCACCCAGCTGACAGCTGACTCCCACCCCAGCTATCACACCGACGGGTTCAACTAAATTCA

GGAGAGGCTGTGATTAGAGGATGAATCAGCATCTGGCCACTGCAACCTTAGAATCATGAACTGTAGTCACTGAGATGGGAAGGCAGCCGTCAACCTGACC

TGCTCTGGCTGGTCAGGGCCACTCCCACCTCCTCTAAGTCCACCCATCTGTCAATCCTTGATACATGAAGTGCGTAGCATGCAGTATTTAAAGCAGTGTA

GCTACGGTCTTCTTCTGTTTTATCCTTTTTTTAATAGCATGTATGGGTTATGTTCAATGTCTGTGTTGTGGACGTGCTGCAGCTGGGCTGAATTAACTGG

ATGGTAGTGCTTATTTTGGGTTTTCAGCCAAGCGGGTCCAGTGAAGGTTCAGCTGTCTCCTTGTGCTTACAGGAGTCAGGTAAGCACCTGGAGCTACATC

TCCTTGTTGGCCTCTGTGTCCTGTGATATGGTCTAGTCCATGGCTCTGATCTCATCCTCAAGGCTGCAGACAGGGCTCTGATATCACCTGCAAAGGAGGG

AACTGGGCCCCGTCTTCCAGGCACCACCAGCATCAGTCGTTTGCACGGTGTTCGTGTTGGGAAGCTTTCATAGGGTCTCTGCATCATCTCACTCGGCCTC

GTGACAGTTTTCCTGTTAGATCTGCTATGGAGAGTGCAGGTATGCCCCTTCTGAAAGTGGGAGCACACTCTGTGTAATGTCACTATCTTGGGTCTCCTGG

CCTTGTGGACTGAAATCCTATCATTGGAGGCATGTCTCTTGCTGGTGTGTGGGAAATCATTTGTCTCTGTTCTGCACCTTTCCAGGTCAAAAGCTGGATT

GACGGGGCCACAGCCTCCTTCCCTCATTCCTGGGTCATCTTCCACATTCCTTCAAGCCAACCTTTTAATCTTTTTTGGACTTTTAAGAACCACAAATGGC

AGCACCTGCCACTTAGTCATAGTCAGAAAGTCTCTTGAGTCCAGTTGTGGGTGGCATGCAACTGCTTATGCAGAGTCTGAGTGCCCAGGCTCCAGAACCT

CCTCCCTGTGCTTGCCAGTGCCCCACCCCCTGCTTGCCTTCGCTTCCACCTGTCACTATCAATGCCTCTGGCAGCTGGAGTGTTGGGTTCCTGGAGCAGG

TGGCTGGACCCTGGTGCTCCTGGCTCAGAAGGGTTGGCTTCTAGGGAAGCTATGGTAGTAGTCACTCAACCTGGGAGGCCAGCTCCCGGCCACAGGATTC

CTTTGTGAACCTCTCTCCAGTCAGTATTCCAGTCTTGGTTCTAGGGTACCATGGTGGGTGGAGTTGAAAAATGTGGTTACCAGTGATATGGAGCCATCCT

ACCCTTTTACAGTTAGCTAGATAGTTGTACCAGACTTCAATGAGCCAGGTTCCTCCAGAACCTTCCCGTTGGCTGCTGCTGCCCATCTGCATTTCCAGAA

CAGATGAAGAAGGAGAAGGCTCATGTGGTGGCTCTGTGGCCCAGACAAACCATCATGTGTTTCTGAAGCCCACCCCGCCCACCTCCTGGCCCCAGCTCAC

CAGGGCCTTCAGGACCAGATCAGGTTGTCAGGAAGTTACAAGAAGAGGCAGCACTGTGAGGACAAACATGGCAGTGATCAAGGGAACCCATCCAGGTCCT

GGGAGACACTGATGCCAAGTTCCCAGTTGACCCTACAACAGAACTACATGAGCCAAGATCCTCCCATGGATTTGTTAGTTTCGTTCTTTAAAGGATTTTA

GGGATATCCACTAACATAGTCAGTTAAAAGTAATTTGTAAACATCAGACCTGTGTCTAGATGTAGTGGGATACGCCTATAATCCCAGCACTAGGGAGGCT

GAGGTAGGAGGACCTTGAGTTGTAGACCAGTCTGGGCTTACACAGTAAGACCCTAACTCAAATAAAACAACCTAAAAGAAGAATGAGAAATCTATTAATT

GGCCCATATTTGGGACAAAGGAAAAAGAAGTCACTGGTCAACCTGGGGTGCTGGGCCTCTTTTCCTACAGTGACCAGGAACCAGGTCCAGACTTGTAGAT

GATCAGTTGCAGTCTGGTAGCACACCCCTCCTGCATGTAGCTCTGTGGCCCTTTCCCTCACATCCTAACGAGCTAGATCCTGAACTGGGACTTGTGGTGC

TGTCAGGATGAGAACATGGAAGTTTTGAACCTAGTGTCTTTTGGAATTCGTAAAGCTAAATAAATGATGTTGAACTTGAAACCCTCCATATGTAGATCAG

TTTCAAAGTGATAATAGTGATTGCCACGGCCAGTAAGTACCCTGACCTGTCCCTGTGCAGACTCCCTTGCAGGGTTTTACTATGTTGATCTAAGGTCTCC

TTGATTTCATTTGTCCTAAGCTAAGAACTGGTGAGTCTCAGGATCAGTCTGACTGTTCTTGTCCAAATATAAATATTAAATAGAGAAACACACACACTCC

CCTAACTCCTATACTGGCAGGCAGTGTAGATGGTGCTGTGCTGTGTTGCCCAGAGAGTGCTGGAATCTGTGCATGCAAGCTCATCCTGTGCAGTGGAGAC

CACTTCTGACCTACAGAAAGTAGTCGGGAGAGACCCTGGGGGACCCGTCTACCAAGGCTGCTGGAGTGTAGGTTTCTGTTTGTGCCCAGTGATGTCTTTC

CTTGTCTTCCTTTTGACTGTATTTTAAGATTACTTTAGATGATTCTGTGCAATGTTTATGACCTTTCCTACCCTTCTAATGTTCAGTTAACACAGCCAGT

ACCCAATGGGGAAAAACCAGGCTGGGTGATGGTGGCAGATGCCTTATGTCCCAGCACTTGGGAAGCAGAGGCAGGCGGCTCACGGAGCCTGTTCTACAGA

ACTAGTTCCAGGACAGCCAGGACTACACACAAAGAAATCCTGTCTT
Translation
 - UNI7481 - - UNI17392 - - UNI29488 - - UNI29866 - MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYR - UNI17392 

- - UNI23044 - RKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAK - UNI25389 -

 ALFVVCGLLTCCYCCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDERE EATDTPIVIQPASATETTQLTADSHPSYHTDGFN
Transcript ENSMUST00000108797
Sequence
AGTGTTGCTTCCGCCGTCCTCTGCCGCTGCTACGGCTGTCGCCGCCCGGGATCCTCAGGCCGAGCAGTAGGCCGGCCGGCTGCCCACCACTGCCCCGGGA

CGGAAAGCGGAGCCGCGGAACCGGTGGACCGGCGGGCGTGCCGACAG - UNI7481 - - UNI29488 - GAGATGATTTCTCCGAATTCATTAAGT

GCATCTTCGGAAAAATAATGCAAAAG - UNI17392 - - UNI29866 - ACTAACCTAACATGGCCGACCAGAGGCAGCGCTCACTCTCTACTTCC

GGGGAATCATTATACCATGTTCTTGGACTGGACAAGAATGCAACCTCAGATGACATTAAAAAGTCCTATCG - UNI17392 - - UNI23044 - GA

AGCTGGCCCTGAAGTATCACCCTGACAAGAACCCTGATAACCCAGAGGCTGCAGACAAGTTTAAGGAGATTAACAACGCACACGCCATCCTGACAGACGC

CACGAAAAGAAACATTTATGACAAGTATGGCTCGCTGGGGCTCTATGTGGCGGAGCAGTTTGGGGAGGAGAACGTCAACACCTACTTCGTACTCTCCAGC

TGGTGGGCCAAG - UNI25389 - GCGCTGTTTGTTGTTTGTGGCCTCCTCACCTGCTGCTACTGCTGCTGCTGTTTGTGCTGTTGCTTTAACTGCTG

CTGTGGGAAATGCAAGCCCAAGGCACCTGAGGGTGAGGAGACAGAATTCTACGTATCCCCTGAAGACTTGGAGGCACAGCTGCAGTCTGATGAAAGGG A

GGCTACAGACACACCGATCGTCATACAGCCAGCATCTGCCACAGAGACCACCCAGCTGACAGCTGACTCCCACCCCAGCTATCACACCGACGGGTTCAAC

TAAATTCAGGAGAGGCTGTGATTAGAGGATGAATCAGCATCTGGCCACTGCAACCTTAGAATCATGAACTGTAGTCACTGAGATGGGAAGGCAGCCGTCA

ACCTGACCTGCTCTGGCTGGTCAGGGCCACTCCCACCTCCTCTAAGTCCACCCATCTGTCAATCCTTGATACATGAAGTGCGTAGCATGCAGTATTTAAA

GCAGTGTAGCTACGGTCTTCTTCTGTTTTATCCTTTTTTTAATAGCATGTATGGGTTATGTTCAATGTCTGTGTTGTGGACGTGCTGCAGCTGGGCTGAA

TTAACTGGATGGTAGTGCTTATTTTGGGTTTTCAGCCAAGCGGGTCCAGTGAAGGTTCAGCTGTCTCCTTGTGCTTACAGGAGTCAGGTAAGCACCTGGA

GCTACATCTCCTTGTTGGCCTCTGTGTCCTGTGATATGGTCTAGTCCATGGCTCTGATCTCATCCTCAAGGCTGCAGACAGGGCTCTGATATCACCTGCA

AAGGAGGGAACTGGGCCCCGTCTTCCAGGCACCACCAGCATCAGTCGTTTGCACGGTGTTCGTGTTGGGAAGCTTTCATAGGGTCTCTGCATCATCTCAC

TCGGCCTCGTGACAGTTTTCCTGTTAGATCTGCTATGGAGAGTGCAGGTATGCCCCTTCTGAAAGTGGGAGCACACTCTGTGTAATGTCACTATCTTGGG

TCTCCTGGCCTTGTGGACTGAAATCCTATCATTGGAGGCATGTCTCTTGCTGGTGTGTGGGAAATCATTTGTCTCTGTTCTGCACCTTTCCAGGTCAAAA

GCTGGATTGACGGGGCCACAGCCTCCTTCCCTCATTCCTGGGTCATCTTCCACATTCCTTCAAGCCAACCTTTTAATCTTTTTTGGACTTTTAAGAACCA

CAAATGGCAGCACCTGCCACTTAGTCATAGTCAGAAAGTCTCTTGAGTCCAGTTGTGGGTGGCATGCAACTGCTTATGCAGAGTCTGAGTGCCCAGGCTC

CAGAACCTCCTCCCTGTGCTTGCCAGTGCCCCACCCCCTGCTTGCCTTCGCTTCCACCTGTCACTATCAATGCCTCTGGCAGCTGGAGTGTTGGGTTCCT

GGAGCAGGTGGCTGGACCCTGGTGCTCCTGGCTCAGAAGGGTTGGCTTCTAGGGAAGCTATGGTAGTAGTCACTCAACCTGGGAGGCCAGCTCCCGGCCA

CAGGATTCCTTTGTGAACCTCTCTCCAGTCAGTATTCCAGTCTTGGTTCTAGGGTACCATGGTGGGTGGAGTTGAAAAATGTGGTTACCAGTGATATGGA

GCCATCCTACCCTTTTACAGTTAGCTAGATAGTTGTACCAGACTTCAATGAGCCAGGTTCCTCCAGAACCTTCCCGTTGGCTGCTGCTGCCCATCTGCAT

TTCCAGAACAGATGAAGAAGGAGAAGGCTCATGTGGTGGCTCTGTGGCCCAGACAAACCATCATGTGTTTCTGAAGCCCACCCCGCCCACCTCCTGGCCC

CAGCTCACCAGGGCCTTCAGGACCAGATCAGGTTGTCAGGAAGTTACAAGAAGAGGCAGCACTGTGAGGACAAACATGGCAGTGATCAAGGGAACCCATC

CAGGTCCTGGGAGACACTGATGCCAAGTTCCCAGTTGACCCTACAACAGAACTACATGAGCCAAGATCCTCCCATGGATTTGTTAGTTTCGTTCTTTAAA

GGATTTTAGGGATATCCACTAACATAGTCAGTTAAAAGTAATTTGTAAACATCAGACCTGTGTCTAGATGTAGTGGGATACGCCTATAATCCCAGCACTA

GGGAGGCTGAGGTAGGAGGACCTTGAGTTGTAGACCAGTCTGGGCTTACACAGTAAGACCCTAACTCAAATAAAACAACCTAAAAGAAGAATGAGAAATC

TATTAATTGGCCCATATTTGGGACAAAGGAAAAAGAAGTCACTGGTCAACCTGGGGTGCTGGGCCTCTTTTCCTACAGTGACCAGGAACCAGGTCCAGAC

TTGTAGATGATCAGTTGCAGTCTGGTAGCACACCCCTCCTGCATGTAGCTCTGTGGCCCTTTCCCTCACATCCTAACGAGCTAGATCCTGAACTGGGACT

TGTGGTGCTGTCAGGATGAGAACATGGAAGTTTTGAACCTAGTGTCTTTTGGAATTCGTAAAGCTAAATAAATGATGTTGAACTTGAAACCCTCCATATG

TAGATCAGTTTCAAAGTGATAATAGTGATTGCCACGGCCAGTAAGTACCCTGACCTGTCCCTGTGCAGACTCCCTTGCAGGGTTTTACTATGTTGATCTA

AGGTCTCCTTGATTTCATTTGTCCTAAGCTAAGAACTGGTGAGTCTCAGGATCAGTCTGACTGTTCTTGTCCAAATATAAATATTAAATAGAGAAACACA

CACACTCCCCTAACTCCTATACTGGCAGGCAGTGTAGATGGTGCTGTGCTGTGTTGCCCAGAGAGTGCTGGAATCTGTGCATGCAAGCTCATCCTGTGCA

GTGGAGACCACTTCTGACCTACAGAAAGTAGTCGGGAGAGACCCTGGGGGACCCGTCTACCAAGGCTGCTGGAGTGTAGGTTTCTGTTTGTGCCCAGTGA

TGTCTTTCCTTGTCTTCCTTTTGACTGTATTTTAAGATTACTTTAGATGATTCTGTGCAATGTTTATGACCTTTCCTACCCTTCTAATGTTCAGTTAACA

CAGCCAGTACCCAATGGGGAAAAACCAGGCTGGGTGATGGTGGCAGATGCCTTATGTCCCAGCACTTGGGAAGCAGAGGCAGGCGGCTCACGGAGCCTGT

TCTACAGAACTAGTTCCAGGACAGCCAGGACTACACACAAAGAAATCCTGTCTTAAGAA
Translation
 - UNI7481 - - UNI29488 -  - UNI17392 - - UNI29866 - MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYR - UNI17392

 - - UNI23044 - RKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAK - UNI25389 

- ALFVVCGLLTCCYCCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDERE EATDTPIVIQPASATETTQLTADSHPSYHTDGFN
Transcript ENSMUST00000108796
Sequence
CGCGCGGCCGCCTCCGCGGCTCCCGGAACGCAGAAACTGGTGTGTAGGGAGGCGGGCAGTAAAGGCTCCGAGGCTTGTTCACATTCTGGGACGCAGAAAT

TGCCTTATAGTT - UNI17392 - - UNI29488 - - UNI29866 - ACTAACCTAACATGGCCGACCAGAGGCAGCGCTCACTCTCTACTTCCG

GGGAATCATTATACCATGTTCTTGGACTGGACAAGAATGCAACCTCAGATGACATTAAAAAGTCCTATCG - UNI17392 - - UNI23044 - GAA

GCTGGCCCTGAAGTATCACCCTGACAAGAACCCTGATAACCCAGAGGCTGCAGACAAGTTTAAGGAGATTAACAACGCACACGCCATCCTGACAGACGCC

ACGAAAAGAAACATTTATGACAAGTATGGCTCGCTGGGGCTCTATGTGGCGGAGCAGTTTGGGGAGGAGAACGTCAACACCTACTTCGTACTCTCCAGCT

GGTGGGCCAAG - UNI25389 - GCGCTGTTTGTTGTTTGTGGCCTCCTCACCTGCTGCTACTGCTGCTGCTGTTTGTGCTGTTGCTTTAACTGCTGC

TGTGGGAAATGCAAGCCCAAGGCACCTGAGGGTGAGGAGACAGAATTCTACGTATCCCCTGAAGACTTGGAGGCACAGCTGCAGTCTGATGAAAGGG AG

GCTACAGACACACCGATCGTCATACAGCCAGCATCTGCCACAGAGACCACCCAGCTGACAGCTGACTCCCACCCCAGCTATCACACCGACGGGTTCAACT

AAATTCAGGAGAGGCTGTGATTAGAGGATGAATCAGCATCTGGCCACTGCAACCTTAGAATCATGAACTGTAGTCACTGAGATGGGAAGGCAGCCGTCAA

CCTGACCTGCTCTGGCTGGTCAGGGCCACTCCCACCTCCTCTAAGTCCACCCATCTGTCAATCCTTGATACATGAAGTGCGTAGCATGCAGTATTTAAAG

CAGTGTAGCTACGGTC
Translation
 - UNI17392 - - UNI29488 - - UNI29866 - MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYR - UNI17392 - - UNI23044

 - RKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAK - UNI25389 - ALFVVCGLLTC

CYCCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDERE EATDTPIVIQPASATETTQLTADSHPSYHTDGFN
Transcript ENSMUST00000116365
Sequence
GAGCGTGCGCGTTCTTGCTGCCGCCAGTGTTGCTTCCGCCGTCCTCTGCCGCTGCTACGGCTGTCGCCGCCCGGGATCCTCAGGCCGAGCAGTAGGCCGG

CCGGCTGCCCACCACTGCCCCGGGACGGAAAGCGGAGCCGCGGAACCGGTGGACCGGCGGGCGTGCCGACAG - UNI7481 - - UNI17392 - - 

UNI29488 - - UNI29866 - ACTAACCTAACATGGCCGACCAGAGGCAGCGCTCACTCTCTACTTCCGGGGAATCATTATACCATGTTCTTGGACT

GGACAAGAATGCAACCTCAGATGACATTAAAAAGTCCTATCG - UNI17392 - - UNI23044 - GAAGCTGGCCCTGAAGTATCACCCTGACAAG

AACCCTGATAACCCAGAGGCTGCAGACAAGTTTAAGGAGATTAACAACGCACACGCCATCCTGACAGACGCCACGAAAAGAAACATTTATGACAAGTATG

GCTCGCTGGGGCTCTATGTGGCGGAGCAGTTTGGGGAGGAGAACGTCAACACCTACTTCGTACTCTCCAGCTGGTGGGCCAAG - UNI25389 - GCG

CTGTTTGTTGTTTGTGGCCTCCTCACCTGCTGCTACTGCTGCTGCTGTTTGTGCTGTTGCTTTAACTGCTGCTGTGGGAAATGCAAGCCCAAGGCACCTG

AGGGTGAGGAGACAGAATTCTACGTATCCCCTGAAGACTTGGAGGCACAGCTGCAGTCTGATGAAAGGG GAGGGCACTGACACTGTGCCGAGAGTGTTT

GTGGTGGCATCTGGGACTGTTGAGGTGTGAACGTGGACACTTGAG AGGCTACAGACACACCGATCGTCATACAGCCAGCATCTGCCACAGAGACCACCC

AGCTGACAGCTGACTCCCACCCCAGCTATCACACCGACGGGTTCAACTAAATTCAGGAGAGGCTGTGATTAGAGGATGAATCAGCATCTGGCCACTGCAA

CCTTAGAATCATGAACTGTAGTCACTGAGATGGGAAGGCAGCCGTCAACCTGACCTGCTCTGGCTGGTCAGGGCCACTCCCACCTCCTCTAAGTCCACCC

ATCTGTCAATCCTTGATACATGAAGTGCGTAGCATGCAGTATTTAAAGCAGTGTAGCTACGGTCTTCTTCTGTTTTATCCTTTTTTTAATAGCATGTATG

GGTTATGTTCAATGTCTGTGTTGTGGACGTGCTGCAGCTGGGCTGAATTAACTGGATGGTAGTGCTTATTTTGGGTTTTCAGCCAAGCGGGTCCAGTGAA

GGTTCAGCTGTCTCCTTGTGCTTACAGGAGTCAGGTAAGCACCTGGAGCTACATCTCCTTGTTGGCCTCTGTGTCCTGTGATATGGTCTAGTCCATGGCT

CTGATCTCATCCTCAAGGCTGCAGACAGGGCTCTGATATCACCTGCAAAGGAGGGAACTGGGCCCCGTCTTCCAGGCACCACCAGCATCAGTCGTTTGCA

CGGTGTTCGTGTTGGGAAGCTTTCATAGGGTCTCTGCATCATCTCACTCGGCCTCGTGACAGTTTTCCTGTTAGATCTGCTATGGAGAGTGCAGGTATGC

CCCTTCTGAAAGTGGGAGCACACTCTGTGTAATGTCACTATCTTGGGTCTCCTGGCCTTGTGGACTGAAATCCTATCATTGGAGGCATGTCTCTTGCTGG

TGTGTGGGAAATCATTTGTCTCTGTTCTGCACCTTTCCAGGTCAAAAGCTGGATTGACGGGGCCACAGCCTCCTTCCCTCATTCCTGGGTCATCTTCCAC

ATTCCTTCAAGCCAACCTTTTAATCTTTTTTGGACTTTTAAGAACCACAAATGGCAGCACCTGCCACTTAGTCATAGTCAGAAAGTCTCTTGAGTCCAGT

TGTGGGTGGCATGCAACTGCTTATGCAGAGTCTGAGTGCCCAGGCTCCAGAACCTCCTCCCTGTGCTTGCCAGTGCCCCACCCCCTGCTTGCCTTCGCTT

CCACCTGTCACTATCAATGCCTCTGGCAGCTGGAGTGTTGGGTTCCTGGAGCAGGTGGCTGGACCCTGGTGCTCCTGGCTCAGAAGGGTTGGCTTCTAGG

GAAGCTATGGTAGTAGTCACTCAACCTGGGAGGCCAGCTCCCGGCCACAGGATTCCTTTGTGAACCTCTCTCCAGTCAGTATTCCAGTCTTGGTTCTAGG

GTACCATGGTGGGTGGAGTTGAAAAATGTGGTTACCAGTGATATGGAGCCATCCTACCCTTTTACAGTTAGCTAGATAGTTGTACCAGACTTCAATGAGC

CAGGTTCCTCCAGAACCTTCCCGTTGGCTGCTGCTGCCCATCTGCATTTCCAGAACAGATGAAGAAGGAGAAGGCTCATGTGGTGGCTCTGTGGCCCAGA

CAAACCATCATGTGTTTCTGAAGCCCACCCCGCCCACCTCCTGGCCCCAGCTCACCAGGGCCTTCAGGACCAGATCAGGTTGTCAGGAAGTTACAAGAAG

AGGCAGCACTGTGAGGACAAACATGGCAGTGATCAAGGGAACCCATCCAGGTCCTGGGAGACACTGATGCCAAGTTCCCAGTTGACCCTACAACAGAACT

ACATGAGCCAAGATCCTCCCATGGATTTGTTAGTTTCGTTCTTTAAAGGATTTTAGGGATATCCACTAACATAGTCAGTTAAAAGTAATTTGTAAACATC

AGACCTGTGTCTAGATGTAGTGGGATACGCCTATAATCCCAGCACTAGGGAGGCTGAGGTAGGAGGACCTTGAGTTGTAGACCAGTCTGGGCTTACACAG

TAAGACCCTAACTCAAATAAAACAACCTAAAAGAAGAATGAGAAATCTATTAATTGGCCCATATTTGGGACAAAGGAAAAAGAAGTCACTGGTCAACCTG

GGGTGCTGGGCCTCTTTTCCTACAGTGACCAGGAACCAGGTCCAGACTTGTAGATGATCAGTTGCAGTCTGGTAGCACACCCCTCCTGCATGTAGCTCTG

TGGCCCTTTCCCTCACATCCTAACGAGCTAGATCCTGAACTGGGACTTGTGGTGCTGTCAGGATGAGAACATGGAAGTTTTGAACCTAGTGTCTTTTGGA

ATTCGTAAAGCTAAATAAATGATGTTGAACTTGAAACCCTCCATATGTAGATCAGTTTCAAAGTGATAATAGTGATTGCCACGGCCAGTAAGTACCCTGA

CCTGTCCCTGTGCAGACTCCCTTGCAGGGTTTTACTATGTTGATCTAAGGTCTCCTTGATTTCATTTGTCCTAAGCTAAGAACTGGTGAGTCTCAGGATC

AGTCTGACTGTTCTTGTCCAAATATAAATATTAAATAGAGAAACACACACACTCCCCTAACTCCTATACTGGCAGGCAGTGTAGATGGTGCTGTGCTGTG

TTGCCCAGAGAGTGCTGGAATCTGTGCATGCAAGCTCATCCTGTGCAGTGGAGACCACTTCTGACCTACAGAAAGTAGTCGGGAGAGACCCTGGGGGACC

CGTCTACCAAGGCTGCTGGAGTGTAGGTTTCTGTTTGTGCCCAGTGATGTCTTTCCTTGTCTTCCTTTTGACTGTATTTTAAGATTACTTTAGATGATTC

TGTGCAATGTTTATGACCTTTCCTACCCTTCTAATGTTCAGTTAACACAGCCAGTACCCAATGGGGAAAAACCAGGCTGGGTGATGGTGGCAGATGCCTT

ATGTCCCAGCACTTGGGAAGCAGAGGCAGGCGGCTCACGGAGCCTGTTCTACAGAACTAGTTCCAGGACAGCCAGGACTACACACAAAGAAATCCTGTCT

TAAGAAG
Translation
 - UNI7481 - - UNI17392 - - UNI29488 - - UNI29866 - MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYR - UNI17392 

- - UNI23044 - RKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAK - UNI25389 -

 ALFVVCGLLTCCYCCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDERG GGH 

For any suggestions or comments, please send an email to unitrap@crg.es