Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000000881 (Dlg3)
Chromosomal location
Chr X: 97963086 - 98013747 (+)
Description
discs, large homolog 3 (Drosophila) Gene [Source:MGI (curated);Acc:Dlg3-003]
RefSeq_dna
NM_016747 
RefSeq_peptide
NP_058027.1 
UniGene
Mm.4615 Mm.401042 
MGI
MGI:1888986 
Uniprot/SWISSPROT
P70175 
Uniprot/SPTREMBL
A2BEF2 Q52KF7 A2BEE9 Q80TH1 A2BEF1 
Human Ortholog
ENSG00000082458 (DLG3)
Omim 300189 - DISCS LARGE, DROSOPHILA, HOMOLOG OF, 3  
UniTrap UNI20160
Vector Insertion
Chr X: 97971821 - 97992024
Public Clones IST14209B11 (tigm)
Private Clones OST370985 (lexicon) OST359371 (lexicon) OST359301 (lexicon) OST226727 (lexicon)
OST166226 (lexicon) OST124545 (lexicon) OST113151 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19903
Vector Insertion
Chr X: 97992140 - 98001850
Public Clones (sanger) E022G06 (ggtc)
Private Clones OST377589 (lexicon) OST147687 (lexicon)
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23581
Vector Insertion
Chr X: 98002028 - 98002518
Public Clones not available
Private Clones OST252609 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113735
Sequence
ATGGAGACGGCTCGCAAGTTCTCAGGCTCAAGCTTGGCCCTGGGTTTGGGCTCGGCCTCTGCTTCAGCCTGGAGGAGGGCTTCGCAGAGGTGGGCCTGGC

CGCTCCGTTCCCTGCGGCCTGGAGGGGATGCCAG AGAGCCCCGCAAGATCATCCTGCACAAAGGTTCTACAGGCCTGGGCTTCAACATTGTAGGAGGAG

AAGATGGAGAAGGCATTTTTGTTTCCTTCATCCTGGCGGGAGGCCCAGCAGACCTAAGTGGGGAGTTGCGAAGGGGAGACCGGATCTTATCG GTAAATG

GAGTCAACCTGAGGAATGCTACCCACGAGCAAGCAGCGGCTGCTCTGAAACGGGCTGGCCAGTCAGTCACCATTGTGGCCCAGTATAGACCTGAAG - U

NI20160 - AGTACAGTCGCTTTGAATCCAAGATCCATGACTTGCGGGAACAAATGATGAACAGCAGCATGAGTTCTGGGTCTGGGTCTCTCCGAACCA

GTGAGAAGAGGTCCTTGTATGTCAG - UNI19903 - GGCCCTGTTTGATTATGATCGGACTCGTGACAGCTGTCTACCAAGCCAGGGACTCAGTTTC

TCTTATGGTGACATTCTGCACGTCATTAACGCCTCTGATGATGAGTGGTGGCAAGCAAGGCTGGTGACTCCTCATGGAGAGAGTGAACAGATCGGTGTGA

TCCCTAGTAAAAAGAG - UNI23581 - GGTGGAAAAGAAAGAGCGAGCTCGATTGAAAACTGTGAAGTTCCATGCCAGGACAGGGATGATTGAGTCT

AATCGG TCGATCAAAACGAAACGTAAAAAGAGTTTTCGCCTCTCTCGAAAGTTTCCATTTTACAAGAGCAAAGAAAACATGGCCCAGGAGAACAGCATA

CAGGAAC AGGGAGTGACATCCAACACCAGTGACAGCGAAAGCAGTTCCA AAGGACAAGAGGATGCTATTTTGTCATATGAGCCAGTGACACGACAAGA

AA TTCACTATGCCAGGCCTGTGATCATCTTGGGCCCAATGAAGGACCGAGTCAACGATGACCTCATCTCTGAGTTCCCGCATAAATTTGGATCCTGTGT

GCCAC ATACCACCCGGCCTCGGCGTGATAACGAGGTAGATGGACAGGATTACCACTTTGTGGTTTCCCGGGAACAAATGGAGAAGGATATTCAGGACAA

CAAGTTCATTGAGGCGGGCCAGTTCAATGATAATCTCTATGGGACCAGCATCCAGTCTGTGCGGGCAGTTGCAGAGAGG GGCAAGCACTGCATCTTAGA

TGTCTCCGGCAACGCCATAAAGAGACTGCAGCAAGCACAACTTTATCCCATTGCCATTTTCATCAAGCCCAAGTCCATTGAAGCACTTAT GGAAATGAA

CCGACGGCAGACATACGAACAAGCAAATAAGATCTTTGATAAAGCCATGAAACTGGAGCAAGAATTTGGAGAATACTTTACAG CCATTGTACAGGGTGA

CTCACTGGAAGAGATTTATAACAAAATCAAACAAATCATTGAGGACCAGTCTGGGCACTACATTTGGGTCCCATCCCCTGAAAAACTCTGAAGAATCCCC

TCCAAGCATTCTCTTGTGAACAGAAGAAATGAAGCCCCTCTTCCCTCCTTCCTCTTCATTCCTGTCCCCACGGGGAGAACAAATGACTACTGTTCTTGTC

CCCCTTTTTAGATATGTCAAAAATTGAGTTTTCTAGTCCTGTTCTTTTTTAAAAAATGTTGTTTTGTTTTGGTTTCTCTTTCGGGATGATGCCATCTCAC

TCATCACGTGACCGTGCCCATTCCTGCATGGACCTTTCCCACGCGCTAGCACAGGTGCAAATCCATCAGAGTTGTTGTTCTCATAAACACCCAGCAGAAG

CGAAGAGAAGAGAGGAGGACTGATGGAAAGACAGACTCTGGACAACTGCACAGCTTGTGAAGTGAGCGAAACAGCCCACGTGAGGAGGCGCTCCCGGGCA

TTCCTACCCTGTACTGCGGCTTGCAGCTCTGAACGGTGCAACGTAACGGCTACAGAAAGGATCTTATTTATATATAGATATATATATGTAATTTATATAA

AATATATAGAAATTATTATATATATATATTATACACTCTTCTATAATATATATATATATATTCACATACATTGGGACTAGAAAATCTATGGAGACGTCCA

TCAACGGTACTATGTTATTAGAGAAATGCTTTAATTTTCATATTCCAATCAGATGACATCTTTTGTTCCACCTGGTTGGGAAGGGGTTGACAACAGTAGT

AAGTGCTATACCAAAGCACTCGAATTTGGTCATTCTCTTCAGAGCTAAGGCTTGCTCCAGGTGGGGCCAACCTACAGCATAAGAGAAGGGGCTTTGGCTG

GGAGCTGGAGATTGGAGACGTGACTAAAGCAGTTGCTGCCCCTGCAGGGCAGTCGTTCCTGTGCAGAAAGAGAGAATGAATGGCTAATGATGCTCCGGAT

GAAATTGCCTATTGTTTTATGCCGCCTGATGTGTCTGCATGAGAGGTTTCCTTTTTGTTCATTTTTAAGCTGCTGTTAAACCAAAACCATGTTGTGCTAC

TGTGTCAGCCTTTTCATTATTCCAGATTTTACTTTTACTATTTAAGTGAATGCGTAGAATCCTATTTGCCAGTGTTCTAAAGGCTTGTGAGGTTCTGAAG

GAGCCAGGCCTGGGATACAGCGGTAACTTAGGCCTGGCCATCCAGTCAACAGAGGGAAAGCAGGGGCTGGTGAGGGCAGAGAGTACAAGCTGGGGCTCGG

AGTTACCATGCTGGACTTAGCTAGGGGTTCCTTCACGGGGCCACTGACAGGCATAGGGAGGTGCTTGCCTTCTGGCTCGGTGCTGGGACAGTGGAAGAGC

ACCAGGCTTGGCCAGCCGTGTAGTGAGTTGGATTTGGATTCTTTTCTTTTGCAACTGCTCCATTTGCCCTACCCCAGCCCCCTCACCAACAGCTGGTAGC

TTACTGTTTCTTCAAGAAGAAAGTAGACTTTAACGCTGTAAATTTGAGCTGTAGAGCTAAGACTCGCTTACTGGTGAGCTGTGAAATCTTGTTGCTTTTT

TCCCAGAGTCTGATGGCAGTGACTGGTCCAGGTAGTTTCCCTCCCGCAGCCAGTGCAGGCAGCAGGTGTGGTCCAGGCCCTACCCCACCCCACTATGCTC

CTTTGAAGCCAACGTGCCTCCCTCACCTCCACACTGGAGGGATGACGCAGGGGAGAACATAGAATTGCTTGGCCCTCAACTGGGTTAGGACCATCGCAGG

TGATGCAGGGTTGACACTTTAAAGCACTACCAGCCACATTCAGGAACTCTGTTCACAGGTATCCTACCAGCATAATGAGGCTAACTGTGACTCGTGGGGC

CCAGAGTTAGAAGAAAGAAAAGGCAGCAGCTTTCTCTTGGGCAGTACACTGGATTGAAGGCAAAGAGGGATAAAGTGACAGATGATTGTGACTCTCGCGA

GGGGGGGTGAGCGGGAAGTGTTGATTCTCTGATGGTAACTGACAGCAGTGGACAGTGCTCAATCCTCCCTCCCAGGGAAGAAAAGCAAAGATTCGAAGTA

AGCATGATAATAGTTGGTTTACCAGTGTTCCTTCCAAGGAGACATATATTTTTTAATAAATGATAGTTGCAATG
Translation
METARKFSGSSLALGLGSASASAWRRASQRWAWPLRSLRPGGDAR REPRKIILHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELRRGDRILS 

VNGVNLRNATHEQAAAALKRAGQSVTIVAQYRPEE - UNI20160 - EYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVR - UNI19903 

- RALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKR - UNI23581 - RVEKKERARLKTVKFHARTGMIES

NR SIKTKRKKSFRLSRKFPFYKSKENMAQENSIQEQ QGVTSNTSDSESSSK KGQEDAILSYEPVTRQEI IHYARPVIILGPMKDRVNDDLISEFPH

KFGSCVPH HTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAER GKHCILDVSGNAIKRLQQAQLYPIAIFIKPKS

IEALM MEMNRRQTYEQANKIFDKAMKLEQEFGEYFTA AIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL
Transcript ENSMUST00000000901
Sequence
GGGACCTGAGCAGAAGAGGTTCTCGCCGCACCTAGCCTTTGCCTGGGCGCCCGATTCTTCTTTGCCGCTGGGCCTCGGCCCAGAAGCCACAACGGGCGAC

ACGGAGCCGCCAGTGCTGGAGGGGGAGCCATGGGTGCGGGGCAGCGTGGGGGCAGAGGCCCCAGGACGCCCGCCCGGCCCCAGGCCCCGCTCAGCCAGGG

CACCCCCACGGGTGCCCCCTCCTTCTTGGTCTGAGCAGTGCGAGTGTGCTAGGGAGCCCGGCGGCGGCGGCGGCGGCGTGGAAACTGGCGTGGGCTGGGG

GGTCCGAGCCGCGGGGGGCAGTGCCATGCACAAGCACCAGCACTGCTGTAAGTGCCCCGAGTGCTATGAGGTGACCCGCCTGGCCGCCCTGCGGCGTCTT

GAGCCTCCTGGCTACGGGGACTGGCAGGTGCCGGACCCCTATGGGCCAAGTGGGGGCAATGGGGCTAGCTCCGGTTATGGAGGCTACAGCTCGCAGACCC

TGCCTTCACAGGCAGGGGCTACCCCCACCCCTCGCACCAAGGCCAAGCTCATCCCCACAGGCCGAGATGTGGGGCCAGTGCCCCCTAAGCCAGTCCCCGG

CAAGAGCACCCCAAAACTCAACGGCAGTGGCCCCGGCTGGTGGCCCGAGTGCACCTGTACCAACCGGGACTGGTATGAGCAG GTGAATGGCAGTGATGG

CATGTTCAAGTATGAGGAGATAGTACTGGAACGG GGCAACTCTGGCCTTGGCTTCAGTATCGCAGGTGGCATCGACAACCCTCATGTCCCTGATGACCC

TGGCATCTTTATTACCAAGATCATTCCTGGTGGAGCAGCTGCCATGGATGGGAGGCTGGG GGTGAATGACTGTGTGCTACGGGTGAATGAGGTGGACGT

GTCCGAGGTGGTGCACAGCCGGGCCGTGGAGGCACTGAAGGAGGCAGGCCCTGTGGTGCGGTTGGTGGTGCGGAGGCGACAGCCCCCACCTGAGACTATC

ATGGAGGTCAACCTGCTCAAAGGGCCAAAAG GCCTAGGTTTCAGCATTGCTGGGGGCATTGGCAACCAGCACATCCCAGGAGACAACAGCATCTATATC

ACCAAGATCATTGAAGGAGGAGCTGCTCAGAAGGATGGACGCCTACAGATTGGGGACCGGCTGCTTGCG GTGAACAATACCAATCTGCAGGATGTGAGG

CATGAGGAAGCTGTGGCCTCACTCAAGAACACATCAGACATGGTCTATCTGAAGGTGGCCAAGCCAGGCAGCATCCACCTCAACGATATGTATGCTCCCC

CTGACTATGCCAGCA CTTTCACTGCCTTGGCTGACAATCACATAAGCCATAATTCCAGCCTGGGTTATCTTGGGGCAGTGGAGAGCAAGGTCACCTACC

CTGCTCCACCTCAGGTGCCCCCTACTCGTTACTCTCCTATTCCCAGACACATGCTGGCTGAGGAAGACTTTACCAG AGAGCCCCGCAAGATCATCCTGC

ACAAAGGTTCTACAGGCCTGGGCTTCAACATTGTAGGAGGAGAAGATGGAGAAGGCATTTTTGTTTCCTTCATCCTGGCGGGAGGCCCAGCAGACCTAAG

TGGGGAGTTGCGAAGGGGAGACCGGATCTTATCG GTAAATGGAGTCAACCTGAGGAATGCTACCCACGAGCAAGCAGCGGCTGCTCTGAAACGGGCTGG

CCAGTCAGTCACCATTGTGGCCCAGTATAGACCTGAAG - UNI20160 - AGTACAGTCGCTTTGAATCCAAGATCCATGACTTGCGGGAACAAATGA

TGAACAGCAGCATGAGTTCTGGGTCTGGGTCTCTCCGAACCAGTGAGAAGAGGTCCTTGTATGTCAG - UNI19903 - GGCCCTGTTTGATTATGAT

CGGACTCGTGACAGCTGTCTACCAAGCCAGGGACTCAGTTTCTCTTATGGTGACATTCTGCACGTCATTAACGCCTCTGATGATGAGTGGTGGCAAGCAA

GGCTGGTGACTCCTCATGGAGAGAGTGAACAGATCGGTGTGATCCCTAGTAAAAAGAG - UNI23581 - GGTGGAAAAGAAAGAGCGAGCTCGATTG

AAAACTGTGAAGTTCCATGCCAGGACAGGGATGATTGAGTCTAATCGG GACTTCCCTGGGTTAAGTGACGATTATTATGGAGCAAAGAACCTGA AAGG

ACAAGAGGATGCTATTTTGTCATATGAGCCAGTGACACGACAAGAAA TTCACTATGCCAGGCCTGTGATCATCTTGGGCCCAATGAAGGACCGAGTCAA

CGATGACCTCATCTCTGAGTTCCCGCATAAATTTGGATCCTGTGTGCCAC ATACCACCCGGCCTCGGCGTGATAACGAGGTAGATGGACAGGATTACCA

CTTTGTGGTTTCCCGGGAACAAATGGAGAAGGATATTCAGGACAACAAGTTCATTGAGGCGGGCCAGTTCAATGATAATCTCTATGGGACCAGCATCCAG

TCTGTGCGGGCAGTTGCAGAGAGG GGCAAGCACTGCATCTTAGATGTCTCCGGCAACGCCATAAAGAGACTGCAGCAAGCACAACTTTATCCCATTGCC

ATTTTCATCAAGCCCAAGTCCATTGAAGCACTTAT GGAAATGAACCGACGGCAGACATACGAACAAGCAAATAAGATCTTTGATAAAGCCATGAAACTG

GAGCAAGAATTTGGAGAATACTTTACAG CCATTGTACAGGGTGACTCACTGGAAGAGATTTATAACAAAATCAAACAAATCATTGAGGACCAGTCTGGG

CACTACATTTGGGTCCCATCCCCTGAAAAACTCTGAAGAATCCCCTCCAAGCATTCTCTTGTGAACAGAAGAAATGAAGCCCCTCTTCCCTCCTTCCTCT

TCATTCCTGTCCCCACGGGGAGAACAAATGACTACTGTTCTTGTCCCCCTTTTTAGATATGTCAAAAATTGAGTTTTCTAGTCCTGTTCTTTTTTAAAAA

ATGTTGTTTTGTTTTGGTTTCTCTTTCGGGATGATGCCATCTCACTCATCACGTGACCGTGCCCATTCCTGCATGGACCTTTCCCACGCGCTAGCACAGG

TGCAAATCCATCAGAGTTGTTGTTCTCATAAACACCCAGCAGAAGCGAAGAGAAGAGAGGAGGACTGATGGAAAGACAGACTCTGGACAACTGCACAGCT

TGTGAAGTGAGCGAAACAGCCCACGTGAGGAGGCGCTCCCGGGCATTCCTACCCTGTACTGCGGCTTGCAGCTCTGAACGGTGCAACGTAACGGCTACAG

AAAGGATCTTATTTATATATAGATATATATATGTAATTTATATAAAATATATAGAAATTATTATATATATATATTATACACTCTTCTATAATATATATAT

ATATATTCACATACATTGGGACTAGAAAATCTATGGAGACGTCCATCAACGGTACTATGTTATTAGAGAAATGCTTTAATTTTCATATTCCAATCAGATG

ACATCTTTTGTTCCACCTGGTTGGGAAGGGGTTGACAACAGTAGTAAGTGCTATACCAAAGCACTCGAATTTGGTCATTCTCTTCAGAGCTAAGGCTTGC

TCCAGGTGGGGCCAACCTACAGCATAAGAGAAGGGGCTTTGGCTGGGAGCTGGAGATTGGAGACGTGACTAAAGCAGTTGCTGCCCCTGCAGGGCAGTCG

TTCCTGTGCAGAAAGAGAGAATGAATGGCTAATGATGCTCCGGATGAAATTGCCTATTGTTTTATGCCGCCTGATGTGTCTGCATGAGAGGTTTCCTTTT

TGTTCATTTTTAAGCTGCTGTTAAACCAAAACCATGTTGTGCTACTGTGTCAGCCTTTTCATTATTCCAGATTTTACTTTTACTATTTAAGTGAATGCGT

AGAATCCTATTTGCCAGTGTTCTAAAGGCTTGTGAGGTTCTGAAGGAGCCAGGCCTGGGATACAGCGGTAACTTAGGCCTGGCCATCCAGTCAACAGAGG

GAAAGCAGGGGCTGGTGAGGGCAGAGAGTACAAGCTGGGGCTCGGAGTTACCATGCTGGACTTAGCTAGGGGTTCCTTCACGGGGCCACTGACAGGCATA

GGGAGGTGCTTGCCTTCTGGCTCGGTGCTGGGACAGTGGAAGAGCACCAGGCTTGGCCAGCCGTGTAGTGAGTTGGATTTGGATTCTTTTCTTTTGCAAC

TGCTCCATTTGCCCTACCCCAGCCCCCTCACCAACAGCTGGTAGCTTACTGTTTCTTCAAGAAGAAAGTAGACTTTAACGCTGTAAATTTGAGCTGTAGA

GCTAAGACTCGCTTACTGGTGAGCTGTGAAATCTTGTTGCTTTTTTCCCAGAGTCTGATGGCAGTGACTGGTCCAGGTAGTTTCCCTCCCGCAGCCAGTG

CAGGCAGCAGGTGTGGTCCAGGCCCTACCCCACCCCACTATGCTCCTTTGAAGCCAACGTGCCTCCCTCACCTCCACACTGGAGGGATGACGCAGGGGAG

AACATAGAATTGCTTGGCCCTCAACTGGGTTAGGACCATCGCAGGTGATGCAGGGTTGACACTTTAAAGCACTACCAGCCACATTCAGGAACTCTGTTCA

CAGGTATCCTACCAGCATAATGAGGCTAACTGTGACTCGTGGGGCCCAGAGTTAGAAGAAAGAAAAGGCAGCAGCTTTCTCTTGGGCAGTACACTGGATT

GAAGGCAAAGAGGGATAAAGTGACAGATGATTGTGACTCTCGCGAGGGGGGGTGAGCGGGAAGTGTTGATTCTCTGATGGTAACTGACAGCAGTGGACAG

TGCTCAATCCTCCCTCCCAGGGAAGAAAAGCAAAGATTCGAAGTAAGCATGATAATAGTTGGTTTACCAGTGTTCCTTCCAAGGAGACATATATTTTTTA

ATAAATGATAGTTGCAATG
Translation
MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPSGGNGASSGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNG

SGPGWWPECTCTNRDWYEQ VNGSDGMFKYEEIVLER GNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLG GVNDCVLRVNEVDVSEVVH

SRAVEALKEAGPVVRLVVRRRQPPPETIMEVNLLKGPKG GLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLA VNNTNLQDVRHEE

AVASLKNTSDMVYLKVAKPGSIHLNDMYAPPDYAST TFTALADNHISHNSSLGYLGAVESKVTYPAPPQVPPTRYSPIPRHMLAEEDFTR REPRKIIL

HKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELRRGDRILS VNGVNLRNATHEQAAAALKRAGQSVTIVAQYRPEE - UNI20160 - EYSRF

ESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVR - UNI19903 - RALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQI

GVIPSKKR - UNI23581 - RVEKKERARLKTVKFHARTGMIESNR DFPGLSDDYYGAKNLK KGQEDAILSYEPVTRQEI IHYARPVIILGPMKD

RVNDDLISEFPHKFGSCVPH HTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAER GKHCILDVSGNAIKRLQQAQ

LYPIAIFIKPKSIEALM MEMNRRQTYEQANKIFDKAMKLEQEFGEYFTA AIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL
Transcript ENSMUST00000113736
Sequence
GGGACCTGAGCAGAAGAGGTTCTCGCCGCACCTAGCCTTTGCCTGGGCGCCCGATTCTTCTTTGCCGCTGGGCCTCGGCCCAGAAGCCACAACGGGCGAC

ACGGAGCCGCCAGTGCTGGAGGGGGAGCCATGGGTGCGGGGCAGCGTGGGGGCAGAGGCCCCAGGACGCCCGCCCGGCCCCAGGCCCCGCTCAGCCAGGG

CACCCCCACGGGTGCCCCCTCCTTCTTGGTCTGAGCAGTGCGAGTGTGCTAGGGAGCCCGGCGGCGGCGGCGGCGGCGTGGAAACTGGCGTGGGCTGGGG

GGTCCGAGCCGCGGGGGGCAGTGCCATGCACAAGCACCAGCACTGCTGTAAGTGCCCCGAGTGCTATGAGGTGACCCGCCTGGCCGCCCTGCGGCGTCTT

GAGCCTCCTGGCTACGGGGACTGGCAGGTGCCGGACCCCTATGGGCCAAGTGGGGGCAATGGGGCTAGCTCCGGTTATGGAGGCTACAGCTCGCAGACCC

TGCCTTCACAGGCAGGGGCTACCCCCACCCCTCGCACCAAGGCCAAGCTCATCCCCACAGGCCGAGATGTGGGGCCAGTGCCCCCTAAGCCAGTCCCCGG

CAAGAGCACCCCAAAACTCAACGGCAGTGGCCCCGGCTGGTGGCCCGAGTGCACCTGTACCAACCGGGACTGGTATGAGCAG GCCAGCCCTGCACCCCT

CCTAGTGAACCCCGAGGCCCTGGAGCCCAGCCTATCG GTGAATGGCAGTGATGGCATGTTCAAGTATGAGGAGATAGTACTGGAACGG GGCAACTCTG

GCCTTGGCTTCAGTATCGCAGGTGGCATCGACAACCCTCATGTCCCTGATGACCCTGGCATCTTTATTACCAAGATCATTCCTGGTGGAGCAGCTGCCAT

GGATGGGAGGCTGGG GGTGAATGACTGTGTGCTACGGGTGAATGAGGTGGACGTGTCCGAGGTGGTGCACAGCCGGGCCGTGGAGGCACTGAAGGAGGC

AGGCCCTGTGGTGCGGTTGGTGGTGCGGAGGCGACAGCCCCCACCTGAGACTATCATGGAGGTCAACCTGCTCAAAGGGCCAAAAG GCCTAGGTTTCAG

CATTGCTGGGGGCATTGGCAACCAGCACATCCCAGGAGACAACAGCATCTATATCACCAAGATCATTGAAGGAGGAGCTGCTCAGAAGGATGGACGCCTA

CAGATTGGGGACCGGCTGCTTGCG GTGAACAATACCAATCTGCAGGATGTGAGGCATGAGGAAGCTGTGGCCTCACTCAAGAACACATCAGACATGGTC

TATCTGAAGGTGGCCAAGCCAGGCAGCATCCACCTCAACGATATGTATGCTCCCCCTGACTATGCCAGCA CTTTCACTGCCTTGGCTGACAATCACATA

AGCCATAATTCCAGCCTGGGTTATCTTGGGGCAGTGGAGAGCAAGGTCACCTACCCTGCTCCACCTCAGGTGCCCCCTACTCGTTACTCTCCTATTCCCA

GACACATGCTGGCTGAGGAAGACTTTACCAG AGAGCCCCGCAAGATCATCCTGCACAAAGGTTCTACAGGCCTGGGCTTCAACATTGTAGGAGGAGAAG

ATGGAGAAGGCATTTTTGTTTCCTTCATCCTGGCGGGAGGCCCAGCAGACCTAAGTGGGGAGTTGCGAAGGGGAGACCGGATCTTATCG GTAAATGGAG

TCAACCTGAGGAATGCTACCCACGAGCAAGCAGCGGCTGCTCTGAAACGGGCTGGCCAGTCAGTCACCATTGTGGCCCAGTATAGACCTGAAG - UNI2

0160 - AGTACAGTCGCTTTGAATCCAAGATCCATGACTTGCGGGAACAAATGATGAACAGCAGCATGAGTTCTGGGTCTGGGTCTCTCCGAACCAGTG

AGAAGAGGTCCTTGTATGTCAG - UNI19903 - GGCCCTGTTTGATTATGATCGGACTCGTGACAGCTGTCTACCAAGCCAGGGACTCAGTTTCTCT

TATGGTGACATTCTGCACGTCATTAACGCCTCTGATGATGAGTGGTGGCAAGCAAGGCTGGTGACTCCTCATGGAGAGAGTGAACAGATCGGTGTGATCC

CTAGTAAAAAGAG - UNI23581 - GGTGGAAAAGAAAGAGCGAGCTCGATTGAAAACTGTGAAGTTCCATGCCAGGACAGGGATGATTGAGTCTAAT

CGG GACTTCCCTGGGTTAAGTGACGATTATTATGGAGCAAAGAACCTGA AAGGACAAGAGGATGCTATTTTGTCATATGAGCCAGTGACACGACAAGA

AA TTCACTATGCCAGGCCTGTGATCATCTTGGGCCCAATGAAGGACCGAGTCAACGATGACCTCATCTCTGAGTTCCCGCATAAATTTGGATCCTGTGT

GCCAC ATACCACCCGGCCTCGGCGTGATAACGAGGTAGATGGACAGGATTACCACTTTGTGGTTTCCCGGGAACAAATGGAGAAGGATATTCAGGACAA

CAAGTTCATTGAGGCGGGCCAGTTCAATGATAATCTCTATGGGACCAGCATCCAGTCTGTGCGGGCAGTTGCAGAGAGG GGCAAGCACTGCATCTTAGA

TGTCTCCGGCAACGCCATAAAGAGACTGCAGCAAGCACAACTTTATCCCATTGCCATTTTCATCAAGCCCAAGTCCATTGAAGCACTTAT GGAAATGAA

CCGACGGCAGACATACGAACAAGCAAATAAGATCTTTGATAAAGCCATGAAACTGGAGCAAGAATTTGGAGAATACTTTACAG CCATTGTACAGGGTGA

CTCACTGGAAGAGATTTATAACAAAATCAAACAAATCATTGAGGACCAGTCTGGGCACTACATTTGGGTCCCATCCCCTGAAAAACTCTGAAGAATCCCC

TCCAAGCATTCTCTTGTGAACAGAAGAAATGAAGCCCCTCTTCCCTCCTTCCTCTTCATTCCTGTCCCCACGGGGAGAACAAATGACTACTGTTCTTGTC

CCCCTTTTTAGATATGTCAAAAATTGAGTTTTCTAGTCCTGTTCTTTTTTAAAAAATGTTGTTTTGTTTTGGTTTCTCTTTCGGGATGATGCCATCTCAC

TCATCACGTGACCGTGCCCATTCCTGCATGGACCTTTCCCACGCGCTAGCACAGGTGCAAATCCATCAGAGTTGTTGTTCTCATAAACACCCAGCAGAAG

CGAAGAGAAGAGAGGAGGACTGATGGAAAGACAGACTCTGGACAACTGCACAGCTTGTGAAGTGAGCGAAACAGCCCACGTGAGGAGGCGCTCCCGGGCA

TTCCTACCCTGTACTGCGGCTTGCAGCTCTGAACGGTGCAACGTAACGGCTACAGAAAGGATCTTATTTATATATAGATATATATATGTAATTTATATAA

AATATATAGAAATTATTATATATATATATTATACACTCTTCTATAATATATATATATATATTCACATACATTGGGACTAGAAAATCTATGGAGACGTCCA

TCAACGGTACTATGTTATTAGAGAAATGCTTTAATTTTCATATTCCAATCAGATGACATCTTTTGTTCCACCTGGTTGGGAAGGGGTTGACAACAGTAGT

AAGTGCTATACCAAAGCACTCGAATTTGGTCATTCTCTTCAGAGCTAAGGCTTGCTCCAGGTGGGGCCAACCTACAGCATAAGAGAAGGGGCTTTGGCTG

GGAGCTGGAGATTGGAGACGTGACTAAAGCAGTTGCTGCCCCTGCAGGGCAGTCGTTCCTGTGCAGAAAGAGAGAATGAATGGCTAATGATGCTCCGGAT

GAAATTGCCTATTGTTTTATGCCGCCTGATGTGTCTGCATGAGAGGTTTCCTTTTTGTTCATTTTTAAGCTGCTGTTAAACCAAAACCATGTTGTGCTAC

TGTGTCAGCCTTTTCATTATTCCAGATTTTACTTTTACTATTTAAGTGAATGCGTAGAATCCTATTTGCCAGTGTTCTAAAGGCTTGTGAGGTTCTGAAG

GAGCCAGGCCTGGGATACAGCGGTAACTTAGGCCTGGCCATCCAGTCAACAGAGGGAAAGCAGGGGCTGGTGAGGGCAGAGAGTACAAGCTGGGGCTCGG

AGTTACCATGCTGGACTTAGCTAGGGGTTCCTTCACGGGGCCACTGACAGGCATAGGGAGGTGCTTGCCTTCTGGCTCGGTGCTGGGACAGTGGAAGAGC

ACCAGGCTTGGCCAGCCGTGTAGTGAGTTGGATTTGGATTCTTTTCTTTTGCAACTGCTCCATTTGCCCTACCCCAGCCCCCTCACCAACAGCTGGTAGC

TTACTGTTTCTTCAAGAAGAAAGTAGACTTTAACGCTGTAAATTTGAGCTGTAGAGCTAAGACTCGCTTACTGGTGAGCTGTGAAATCTTGTTGCTTTTT

TCCCAGAGTCTGATGGCAGTGACTGGTCCAGGTAGTTTCCCTCCCGCAGCCAGTGCAGGCAGCAGGTGTGGTCCAGGCCCTACCCCACCCCACTATGCTC

CTTTGAAGCCAACGTGCCTCCCTCACCTCCACACTGGAGGGATGACGCAGGGGAGAACATAGAATTGCTTGGCCCTCAACTGGGTTAGGACCATCGCAGG

TGATGCAGGGTTGACACTTTAAAGCACTACCAGCCACATTCAGGAACTCTGTTCACAGGTATCCTACCAGCATAATGAGGCTAACTGTGACTCGTGGGGC

CCAGAGTTAGAAGAAAGAAAAGGCAGCAGCTTTCTCTTGGGCAGTACACTGGATTGAAGGCAAAGAGGGATAAAGTGACAGATGATTGTGACTCTCGCGA

GGGGGGGTGAGCGGGAAGTGTTGATTCTCTGATGGTAACTGACAGCAGTGGACAGTGCTCAATCCTCCCTCCCAGGGAAGAAAAGCAAAGATTCGAAGTA

AGCATGATAATAGTTGGTTTACCAGTGTTCCTTCCAAGGAGACATATATTTTTTAATAAATGATAGTTGCAATG
Translation
MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPSGGNGASSGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNG

SGPGWWPECTCTNRDWYEQ ASPAPLLVNPEALEPSLS VNGSDGMFKYEEIVLER GNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLG 

GVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLVVRRRQPPPETIMEVNLLKGPKG GLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIG

DRLLA VNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSIHLNDMYAPPDYAST TFTALADNHISHNSSLGYLGAVESKVTYPAPPQVPPTRYSPIPR

HMLAEEDFTR REPRKIILHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELRRGDRILS VNGVNLRNATHEQAAAALKRAGQSVTIVAQYRPEE

 - UNI20160 - EYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVR - UNI19903 - RALFDYDRTRDSCLPSQGLSFSYGDILHVINAS

DDEWWQARLVTPHGESEQIGVIPSKKR - UNI23581 - RVEKKERARLKTVKFHARTGMIESNR DFPGLSDDYYGAKNLK KGQEDAILSYEPVTR

QEI IHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPH HTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAER G

KHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALM MEMNRRQTYEQANKIFDKAMKLEQEFGEYFTA AIVQGDSLEEIYNKIKQIIEDQSGHYIWVP

SPEKL
Transcript ENSMUST00000087984
Sequence
GGGACCTGAGCAGAAGAGGTTCTCGCCGCACCTAGCCTTTGCCTGGGCGCCCGATTCTTCTTTGCCGCTGGGCCTCGGCCCAGAAGCCACAACGGGCGAC

ACGGAGCCGCCAGTGCTGGAGGGGGAGCCATGGGTGCGGGGCAGCGTGGGGGCAGAGGCCCCAGGACGCCCGCCCGGCCCCAGGCCCCGCTCAGCCAGGG

CACCCCCACGGGTGCCCCCTCCTTCTTGGTCTGAGCAGTGCGAGTGTGCTAGGGAGCCCGGCGGCGGCGGCGGCGGCGTGGAAACTGGCGTGGGCTGGGG

GGTCCGAGCCGCGGGGGGCAGTGCCATGCACAAGCACCAGCACTGCTGTAAGTGCCCCGAGTGCTATGAGGTGACCCGCCTGGCCGCCCTGCGGCGTCTT

GAGCCTCCTGGCTACGGGGACTGGCAGGTGCCGGACCCCTATGGGCCAAGTGGGGGCAATGGGGCTAGCTCCGGTTATGGAGGCTACAGCTCGCAGACCC

TGCCTTCACAGGCAGGGGCTACCCCCACCCCTCGCACCAAGGCCAAGCTCATCCCCACAGGCCGAGATGTGGGGCCAGTGCCCCCTAAGCCAGTCCCCGG

CAAGAGCACCCCAAAACTCAACGGCAGTGGCCCCGGCTGGTGGCCCGAGTGCACCTGTACCAACCGGGACTGGTATGAGCAG GCCAGCCCTGCACCCCT

CCTAGTGAACCCCGAGGCCCTGGAGCCCAGCCTATCG GTGAATGGCAGTGATGGCATGTTCAAGTATGAGGAGATAGTACTGGAACGG GGCAACTCTG

GCCTTGGCTTCAGTATCGCAGGTGGCATCGACAACCCTCATGTCCCTGATGACCCTGGCATCTTTATTACCAAGATCATTCCTGGTGGAGCAGCTGCCAT

GGATGGGAGGCTGGG GGTGAATGACTGTGTGCTACGGGTGAATGAGGTGGACGTGTCCGAGGTGGTGCACAGCCGGGCCGTGGAGGCACTGAAGGAGGC

AGGCCCTGTGGTGCGGTTGGTGGTGCGGAGGCGACAGCCCCCACCTGAGACTATCATGGAGGTCAACCTGCTCAAAGGGCCAAAAG GCCTAGGTTTCAG

CATTGCTGGGGGCATTGGCAACCAGCACATCCCAGGAGACAACAGCATCTATATCACCAAGATCATTGAAGGAGGAGCTGCTCAGAAGGATGGACGCCTA

CAGATTGGGGACCGGCTGCTTGCG GTGAACAATACCAATCTGCAGGATGTGAGGCATGAGGAAGCTGTGGCCTCACTCAAGAACACATCAGACATGGTC

TATCTGAAGGTGGCCAAGCCAGGCAGCATCCACCTCAACGATATGTATGCTCCCCCTGACTATGCCAGCA CTTTCACTGCCTTGGCTGACAATCACATA

AGCCATAATTCCAGCCTGGGTTATCTTGGGGCAGTGGAGAGCAAGGTCACCTACCCTGCTCCACCTCAGGTGCCCCCTACTCGTTACTCTCCTATTCCCA

GACACATGCTGGCTGAGGAAGACTTTACCAG AGAGCCCCGCAAGATCATCCTGCACAAAGGTTCTACAGGCCTGGGCTTCAACATTGTAGGAGGAGAAG

ATGGAGAAGGCATTTTTGTTTCCTTCATCCTGGCGGGAGGCCCAGCAGACCTAAGTGGGGAGTTGCGAAGGGGAGACCGGATCTTATCG GTAAATGGAG

TCAACCTGAGGAATGCTACCCACGAGCAAGCAGCGGCTGCTCTGAAACGGGCTGGCCAGTCAGTCACCATTGTGGCCCAGTATAGACCTGAAG - UNI2

0160 - AGTACAGTCGCTTTGAATCCAAGATCCATGACTTGCGGGAACAAATGATGAACAGCAGCATGAGTTCTGGGTCTGGGTCTCTCCGAACCAGTG

AGAAGAGGTCCTTGTATGTCAG - UNI19903 - GGCCCTGTTTGATTATGATCGGACTCGTGACAGCTGTCTACCAAGCCAGGGACTCAGTTTCTCT

TATGGTGACATTCTGCACGTCATTAACGCCTCTGATGATGAGTGGTGGCAAGCAAGGCTGGTGACTCCTCATGGAGAGAGTGAACAGATCGGTGTGATCC

CTAGTAAAAAGAG - UNI23581 - GGTGGAAAAGAAAGAGCGAGCTCGATTGAAAACTGTGAAGTTCCATGCCAGGACAGGGATGATTGAGTCTAAT

CGG GACTTCCCTGGGTTAAGTGACGATTATTATGGAGCAAAGAACCTGA AGGGAGTGACATCCAACACCAGTGACAGCGAAAGCAGTTCCA AAGGAC

AAGAGGATGCTATTTTGTCATATGAGCCAGTGACACGACAAGAAA TTCACTATGCCAGGCCTGTGATCATCTTGGGCCCAATGAAGGACCGAGTCAACG

ATGACCTCATCTCTGAGTTCCCGCATAAATTTGGATCCTGTGTGCCAC ATACCACCCGGCCTCGGCGTGATAACGAGGTAGATGGACAGGATTACCACT

TTGTGGTTTCCCGGGAACAAATGGAGAAGGATATTCAGGACAACAAGTTCATTGAGGCGGGCCAGTTCAATGATAATCTCTATGGGACCAGCATCCAGTC

TGTGCGGGCAGTTGCAGAGAGG GGCAAGCACTGCATCTTAGATGTCTCCGGCAACGCCATAAAGAGACTGCAGCAAGCACAACTTTATCCCATTGCCAT

TTTCATCAAGCCCAAGTCCATTGAAGCACTTAT GGAAATGAACCGACGGCAGACATACGAACAAGCAAATAAGATCTTTGATAAAGCCATGAAACTGGA

GCAAGAATTTGGAGAATACTTTACAG CCATTGTACAGGGTGACTCACTGGAAGAGATTTATAACAAAATCAAACAAATCATTGAGGACCAGTCTGGGCA

CTACATTTGGGTCCCATCCCCTGAAAAACTCTGAAGAATCCCCTCCAAGCATTCTCTTGTGAACAGAAGAAATGAAGCCCCTCTTCCCTCCTTCCTCTTC

ATTCCTGTCCCCACGGGGAGAACAAATGACTACTGTTCTTGTCCCCCTTTTTAGATATGTCAAAAATTGAGTTTTCTAGTCCTGTTCTTTTTTAAAAAAT

GTTGTTTTGTTTTGGTTTCTCTTTCGGGATGATGCCATCTCACTCATCACGTGACCGTGCCCATTCCTGCATGGACCTTTCCCACGCGCTAGCACAGGTG

CAAATCCATCAGAGTTGTTGTTCTCATAAACACCCAGCAGAAGCGAAGAGAAGAGAGGAGGACTGATGGAAAGACAGACTCTGGACAACTGCACAGCTTG

TGAAGTGAGCGAAACAGCCCACGTGAGGAGGCGCTCCCGGGCATTCCTACCCTGTACTGCGGCTTGCAGCTCTGAACGGTGCAACGTAACGGCTACAGAA

AGGATCTTATTTATATATAGATATATATATGTAATTTATATAAAATATATAGAAATTATTATATATATATATTATACACTCTTCTATAATATATATATAT

ATATTCACATACATTGGGACTAGAAAATCTATGGAGACGTCCATCAACGGTACTATGTTATTAGAGAAATGCTTTAATTTTCATATTCCAATCAGATGAC

ATCTTTTGTTCCACCTGGTTGGGAAGGGGTTGACAACAGTAGTAAGTGCTATACCAAAGCACTCGAATTTGGTCATTCTCTTCAGAGCTAAGGCTTGCTC

CAGGTGGGGCCAACCTACAGCATAAGAGAAGGGGCTTTGGCTGGGAGCTGGAGATTGGAGACGTGACTAAAGCAGTTGCTGCCCCTGCAGGGCAGTCGTT

CCTGTGCAGAAAGAGAGAATGAATGGCTAATGATGCTCCGGATGAAATTGCCTATTGTTTTATGCCGCCTGATGTGTCTGCATGAGAGGTTTCCTTTTTG

TTCATTTTTAAGCTGCTGTTAAACCAAAACCATGTTGTGCTACTGTGTCAGCCTTTTCATTATTCCAGATTTTACTTTTACTATTTAAGTGAATGCGTAG

AATCCTATTTGCCAGTGTTCTAAAGGCTTGTGAGGTTCTGAAGGAGCCAGGCCTGGGATACAGCGGTAACTTAGGCCTGGCCATCCAGTCAACAGAGGGA

AAGCAGGGGCTGGTGAGGGCAGAGAGTACAAGCTGGGGCTCGGAGTTACCATGCTGGACTTAGCTAGGGGTTCCTTCACGGGGCCACTGACAGGCATAGG

GAGGTGCTTGCCTTCTGGCTCGGTGCTGGGACAGTGGAAGAGCACCAGGCTTGGCCAGCCGTGTAGTGAGTTGGATTTGGATTCTTTTCTTTTGCAACTG

CTCCATTTGCCCTACCCCAGCCCCCTCACCAACAGCTGGTAGCTTACTGTTTCTTCAAGAAGAAAGTAGACTTTAACGCTGTAAATTTGAGCTGTAGAGC

TAAGACTCGCTTACTGGTGAGCTGTGAAATCTTGTTGCTTTTTTCCCAGAGTCTGATGGCAGTGACTGGTCCAGGTAGTTTCCCTCCCGCAGCCAGTGCA

GGCAGCAGGTGTGGTCCAGGCCCTACCCCACCCCACTATGCTCCTTTGAAGCCAACGTGCCTCCCTCACCTCCACACTGGAGGGATGACGCAGGGGAGAA

CATAGAATTGCTTGGCCCTCAACTGGGTTAGGACCATCGCAGGTGATGCAGGGTTGACACTTTAAAGCACTACCAGCCACATTCAGGAACTCTGTTCACA

GGTATCCTACCAGCATAATGAGGCTAACTGTGACTCGTGGGGCCCAGAGTTAGAAGAAAGAAAAGGCAGCAGCTTTCTCTTGGGCAGTACACTGGATTGA

AGGCAAAGAGGGATAAAGTGACAGATGATTGTGACTCTCGCGAGGGGGGGTGAGCGGGAAGTGTTGATTCTCTGATGGTAACTGACAGCAGTGGACAGTG

CTCAATCCTCCCTCCCAGGGAAGAAAAGCAAAGATTCGAAGTAAGCATGATAATAGTTGGTTTACCAGTGTTCCTTCCAAGGAGACATATATTTTTTAAT

AAATGATAGTTGCAATG
Translation
MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPSGGNGASSGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNG

SGPGWWPECTCTNRDWYEQ ASPAPLLVNPEALEPSLS VNGSDGMFKYEEIVLER GNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLG 

GVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLVVRRRQPPPETIMEVNLLKGPKG GLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIG

DRLLA VNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSIHLNDMYAPPDYAST TFTALADNHISHNSSLGYLGAVESKVTYPAPPQVPPTRYSPIPR

HMLAEEDFTR REPRKIILHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELRRGDRILS VNGVNLRNATHEQAAAALKRAGQSVTIVAQYRPEE

 - UNI20160 - EYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVR - UNI19903 - RALFDYDRTRDSCLPSQGLSFSYGDILHVINAS

DDEWWQARLVTPHGESEQIGVIPSKKR - UNI23581 - RVEKKERARLKTVKFHARTGMIESNR DFPGLSDDYYGAKNLK KGVTSNTSDSESSSK

 KGQEDAILSYEPVTRQEI IHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPH HTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNL

YGTSIQSVRAVAER GKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALM MEMNRRQTYEQANKIFDKAMKLEQEFGEYFTA AIVQGDSLEEIYNK

IKQIIEDQSGHYIWVPSPEKL

For any suggestions or comments, please send an email to unitrap@crg.es