Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001018 (Snapin)
Chromosomal location
Chr 3: 90291948 - 90294923 (-)
Description
SNAP-associated protein Gene [Source:MGI (curated);Acc:Snapin-001]
RefSeq_dna
NM_133854 
RefSeq_peptide
NP_598615.1 
UniGene
Mm.331182 
MGI
MGI:1333745 
Uniprot/SWISSPROT
Q9Z266 
Uniprot/SPTREMBL
Q3UY32 
Human Ortholog
ENSG00000143553 (SNAPIN)
Omim not available
UniTrap UNI28688
Vector Insertion
Chr 3: 90293516 - 90294075
Public Clones not available
Private Clones OST23550 (lexicon) OST13661 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107351
Sequence
GGCTTTGTAGGGGCGGGGCCCCGAAGAAATACTAGATACATTCTTGAGACACTGATGTTGAGACTGGGTAAATAGGCGGAAGGGCCTGGGTGAGGCCTTG

AAGTTGAGGTTGGCTTGTCTCAGTATTTGGGGAATAAGTAGAATTCGTTTCCCGCGTCCCAGTCACTGACCGTTGTAGACTTTTGTACCACTTTGCAGAG

AAAGCCAAGTAGAGCTCCGGGAACAAATTGACAACCTAGCTACAG AACTGTGCCGGATCAATGAGGATCAGAAAGTGGCCCTGGATCTGGACCCCTATG

TTAAGAAGCTGCTTAATGCCAGGCGACGAGTTGTCTTGGTCAACAATATTTTACAGAATGCACAG - UNI28688 - GAACGACTAAGGCGGTTAAAC

CACAGCGTGGCCAAGGAAACAGCTCGCAGGAGAGCTATGCTGGATTCAGGAGTTTACCCTCCTGGTTCTCCAAGCAAATAAGCACGGGCCCGTGACCTGA

GTATACAAGTACAATTCTCCAACGGCTTTGTCTGGTAGACACGAGAAGATTCCAGGAAAGTCTCTGTAGACCTTTGATTTTTTTTGCACTATGTACTCAT

TCATGTAGCCGCCTCAAGAAACATGCGTACGGCAGGACTATTTCCTAAAGAACCTCCATCACAGCTTGTCCATCCAAGAAAGAGCCTCTACCTTTTGGGT

TTTGTTAATCTTGAGACAAGATCTCAGTATGTAGTCCCGGCTGGCCTCAAACATGTCCTCTTGCCTTAGCCTCCTGAATGCTGGGATTATAATAGGCATG

TGTCAGAGTGCCGGGCTCAAGCCTCTATATATTTCCCCCAAAGAATACTAAGTAAATTAGGCATCGTGTGGTAGAAAATTGAGAAAACACCAGATTTAGT

GAGAAAGTATACTCCTATTTCTCCCCCTCTGCTTCACCACAGTTCCTCTCAGAAGGTAATAACCTTTCCAGGA
Translation
 MRIRKWPWIWTPMLRSCLMPGDELSWSTIFYRMHR - UNI28688 - RND
Transcript ENSMUST00000107352
Sequence
CAATTTCTGGGGATATTTTAGGACAGAATGGAAGAAGGGAAGGTGTCTGTGGCCCACACAAGACTGCAAGAGTATTTTTCATCCCATTCCTCTCTTCCAT

TCCCTAAGAACAAAAAATGAGCCATTAGATGTTGGTTGCCCATTTCCTCTTCCCAGAACTGTGCCGGATCAATGAGGATCAGAAAGTGGCCCTGGATCTG

GACCCCTATGTTAAGAAGCTGCTTAATGCCAGGCGACGAGTTGTCTTGGTCAACAATATTTTACAGAATGCACAG - UNI28688 - GAACGACTAAG

GCGGTTAAACCACAGCGTGGCCAAGGAAACAGCTCGCAGGAGAGCTATGCTGGATTCAGGAGTTTACCCTCCTGGTTCTCCAAGCAAATAAGCACGGGCC

CGTGACCTGAGTATACAAGTACAATTCTCCAACGGCTTTGTCTGGTAGACACGAGAAGATTCCAGGAAAGTCTCTGTAGACCTTTGATTTTTTTTGCACT

ATGTACTCATTCATGTAGCCGCCTCAAGAAACATGCGTACGGCAGGACTATTTCCTAAAGAACCTCCATCACAGCTTGTCCATCCAAGAAAGAGCCTCTA

CCTTTTGGGTTTTGTTAATCTTGAGACAAGATCTCAGTATGTAGTCCCGGCTGGCCTCAAACATGTCCTCTTGCCTTAGCCTCCTGAATGCTGGGATTAT

AATAGGCATGTGTCAGAGTGCCGGGCTCAAGCCTCTATATATTTCCCCCAAAGAATACTAAGTAAATTAGGCATCGTGTGGTAGAAAATTGAGAAAACAC

CAGATTTAGTGAGAAAGTATACTCCTATTTCTCCCCCTCTGCTTCACCACAGTTCCTCTCAGAAGGTAATAACCTTTCCAGGATCATCTTACACTCTATA

ATGTTTAGGTTAACTCCTATTAACAAGTTTCGCAACTGTTGCCTTCATTGCTACCCAAGGAGAGCATGCCAGATAGCGAGGATCCAAGGTCAAGGCAGAG

CCTTGACAGCTAAGAGTCCTAAGCTTTTGCGATTTTTTTTTTTGTTTAGACTACATATTTTAAGGGCTAGAGGGATGGCTCAATGGTTAAGAACACTGGT

GATTCTTCCAGATGGCGTCCAGTGCTTAGCGCCCACATGGTGACTCACAGCAGCCTCTAACTCCAGCTCCAGGGGAACCCAATGCCCTTGTCTGGCCTTT

TGGCCCAGCACACACACACATATGATGCAGATATATATGCAGGCAAAACAACCATCCTCATAAAATAAAATTTAAAAGTTACATATTTAAGCGCCATCCT

TTCCAGGCTTAGCCAGCCAGTGTTAACCATCCTGTTACTCCTATTACTGGGGCTGGGCAGTTTCCTTTACCTGTAACTCCACTTTGTTTACAACTGAGGA

CTTAGGTAAAGTCAAGGTAAATAATTTATCCTCTTGGCCACCCTGGCTTGACTATGTTAATATTAAGTATTGCTCAACATTATTAAATAAATGCTTGTAC

TGGTTATTTTAACAAAAAAATTTATTTTATTATGGTTTCAAAGGGTTCAGGACATGGTCACACTGATGCATATTTTGGGGCCTATTTTGAGACATGAGAA

TGTGAGGTGATCAAGCTTCCAAGAGAAGGGAATGCTGGACTCTGCCATTTATCCCTTTATTCTGTCCATGCACTGAGCTCATAAGATGCTTTCACCCCAC

ATTTAGGGTTAATCCTTTGCAGAAATTTCAGGTTATTTTAGGCCAAGCTGAAGAAATTAGCCATCACAATGGTATCCTAGGAATCTATTACTTTCAATTT

ATATAATTTAAAACAGCAATCTCAATGTTTATAATAAAAGACTCAACTTGAATTCTA
Translation
MLVAHFLFPELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQ - UNI28688 - ERLRRLNHSVAKETARRRAMLDSGVYPPGSPSK
Transcript ENSMUST00000001044
Sequence
AGGCTGAGGGCGTCAGGGCAGTTCGCGATGGCCGCGGCTGGTTCCGCTGCTGTGTCAGGGGCCGGGACCCCAGTGGCGGGGCCCACAGGCCGCGACCTCT

TTGCCGAGGGGCTCCTGGAGTTCCTGCGACCCGCGGTGCAGCAGCTCGACTCTCACGTGCACGCGGTCAG AGAAAGCCAAGTAGAGCTCCGGGAACAAA

TTGACAACCTAGCTACAG AACTGTGCCGGATCAATGAGGATCAGAAAGTGGCCCTGGATCTGGACCCCTATGTTAAGAAGCTGCTTAATGCCAGGCGAC

GAGTTGTCTTGGTCAACAATATTTTACAGAATGCACAG - UNI28688 - GAACGACTAAGGCGGTTAAACCACAGCGTGGCCAAGGAAACAGCTCGC

AGGAGAGCTATGCTGGATTCAGGAGTTTACCCTCCTGGTTCTCCAAGCAAATAAGCACGGGCCCGTGACCTGAGTATACAAGTACAATTCTCCAACGGCT

TTGTCTGGTAGACACGAGAAGATTCCAGGAAAGTCTCTGTAGACCTTTGATTTTTTTTGCACTATGTACTCATTCATGTAGCCGCCTCAAGAAACATGCG

TACGGCAGGACTATTTCCTAAAGAACCTCCATCACAGCTTGTCCATCCAAGAAAGAGCCTCTACCTTTTGGGTTTTGTTAATCTTGAGACAAGATCTCAG

TATGTAGTCCCGGCTGGCCTCAAACATGTCCTCTTGCCTTAGCCTCCTGAATGCTGGGATTATAATAGGCATGTGTCAGAGTGCCGGGCTCAAGCCTCTA

TATATTTCCCCCAAAGAATACTAAGTAAATTAGGCATCGTGTGGTAGAAAATTGAGAAAACACCAGATTTAGTGAGAAAGTATACTCCTATTTCTCCCCC

TCTGCTTCACCACAGTTCCTCTCAGAAGGTAATAACCTTTCCAGGATCATCTTACACTCTATAATGTTTAGGTTAACTCCTATTAACAAGTTTCGCAACT

GTTGCCTTCATTGCTACCCAAGGAGAGCATGCCAGATAGCGAGGATCCAAGGTCAAGGCAGAGCCTTGACAGCTAAGAGTCCTAAGCTTTTGCGATTTTT

TTTTTTGTTTAGACTACATATTTTAAGGGCTAGAGGGATGGCTCAATGGTTAAGAACACTGGTGATTCTTCCAGATGGCGTCCAGTGCTTAGCGCCCACA

TGGTGACTCACAGCAGCCTCTAACTCCAGCTCCAGGGGAACCCAATGCCCTTGTCTGGCCTTTTGGCCCAGCACACACACACATATGATGCAGATATATA

TGCAGGCAAAACAACCATCCTCATAAAATAAAATTTAAAAGTTACATATTTAAGCGCCATCCTTTCCAGGCTTAGCCAGCCAGTGTTAACCATCCTGTTA

CTCCTATTACTGGGGCTGGGCAGTTTCCTTTACCTGTAACTCCACTTTGTTTACAACTGAGGACTTAGGTAAAGTCAAGGTAAATAATTTATCCTCTTGG

CCACCCTGGCTTGACTATGTTAATATTAAGTATTGCTCAACATTATTAAATAAATGCTTGTACTGGTTATTTTAAC
Translation
MAAAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVR RESQVELREQIDNLATE ELCRINEDQKVALDLDPYVKKLLNARRRVVLVN

NILQNAQ - UNI28688 - ERLRRLNHSVAKETARRRAMLDSGVYPPGSPSK

For any suggestions or comments, please send an email to unitrap@crg.es