Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001123 (Lgals9)
Chromosomal location
Chr 11: 78776485 - 78798353 (-)
Description
lectin, galactose binding, soluble 9 Gene [Source:MGI (curated);Acc:Lgals9-001]
RefSeq_dna
NM_010708 
RefSeq_peptide
NP_034838.1 
UniGene
Mm.341434 
MGI
MGI:109496 
Uniprot/SWISSPROT
O08573 
Uniprot/SPTREMBL
Q3UKE5 Q99L83 B1AQR8 
Human Ortholog
ENSG00000168961 (LGALS9)
Omim not available
UniTrap UNI13416
Vector Insertion
Chr 11: 78790204 - 78798279
Public Clones CMHD-GT_488F4-3 (cmhd) CMHD-GT_314G04-3 (cmhd) IST14563B5 (tigm) IST13676D3 (tigm)
IST10900E7 (tigm) IST15031B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31623
Vector Insertion
Chr 11: 78786489 - 78790204
Public Clones IST14055F4 (tigm) IST10056D11 (tigm) IST14645D4 (tigm) IST12676A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16143
Vector Insertion
Chr 11: 78784930 - 78786489
Public Clones IST13077E1 (tigm)
Private Clones OST466078 (lexicon) OST13483 (lexicon) OST6825 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28658
Vector Insertion
Chr 11: 78781536 - 78783215
Public Clones IST12411B1 (tigm)
Private Clones OST24286 (lexicon)
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21542
Vector Insertion
Chr 11: 78780997 - 78781499
Public Clones not available
Private Clones OST326500 (lexicon) OST8529 (lexicon)
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29285
Vector Insertion
Chr 11: 78780421 - 78780945
Public Clones not available
Private Clones OST633 (lexicon)
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108269
Sequence
AGGAAGAGAGCATTGGTTCCCCTGAGATAGAAGAGATGGCTCTCTTCAGTGCCCAGTCTCCATACATTAACCCG - UNI13416 - - UNI31623 -

 ATCATCCCCTTTACTGGACCAATCCAAGGAGGGCTGCAGGAGGGACTTCAGGTGACCCTCCAGGGGACTACCAAGAGTTTTGCACAAAG - UNI3162

3 - GTTTGTGGTGAACTTTCAGAACAGCTTCAATGGAAATGACATTGCCTTCCACTTCAACCCCCGGTTTGAGGAAGGAGGGTATGTGGTTTGCAACAC

GAAGCAGAACGGACAGTGGGGTCCTGAGGAGAGAAAGATGCAGATGCCCTTCCAGAAGGGGATGCCCTTTGAGCTTTGCTTCCTGGTGCAGAGGTCAGAG

TTCAAG - UNI16143 - - UNI31623 - GTGATGGTGAACAAGAAATTCTTTGTGCAGTACCAACACCGCGTACCCTACCACCTCGTGGACACCA

TCGCTGTCTCCGGCTGCTTGAAGCTGTCCTTTATCACCTTCCAG AACTCTGCAGCCCCTGTCCAGCATGTCTTCTCCACAGTGCAGTTCTCTCAGCCAG

TCCAGTTCCCACGGACCCCTAAGGGGCGCAAACAGAAA - UNI28658 - ACTCAGAACTTTCGTCCTGCCCACCAGGCACCCATG - UNI21542 

- GCTCAAACTACCATCCATATGGTTCACAGCACCCCTGGACAGATGTTCTCT - UNI29285 - ACTCCTGGAATCCCTCCTGTGGTGTACCCCACC

CCAGCCTAT ACCATACCTTTCTACACCCCCATTCCAAATGGGCTTTACCCGTCCAAGTCCATCATGATATCAGGCAATGTCTTGCCAGATGCTACGAG 

GTTCCATATCAACCTTCGCTGTGGAGGTGACATTGCTTTCCACCTGAACCCCCGTTTCAATGAGAATGCTGTTGTCCGAAACACTCAGATCAACAACTCC

TGGGGGCAGGAAGAGCGAAGTCTGCTTGGGAGGATGCCCTTCAGTCGAGGCCAGAGCTTCTCG GTGTGGATCATATGTGAAGGTCACTGCTTCAAGGTA

GCTGTGAATGGTCAACACATGTGTGAATATTACCACCGCCTGAAGAACTTGCAGGATATCAACACTCTAGAAGTGGCGGGTGATATCCAGCTGACCCACG

TGCAGACATAGGCAAGGTCTCTGGCCTAGGGATAAGGGCTGGAGCACTCTGCCTGTGTCTTATCTTTCCCCTGTCTCAGCCCTGGCACCATCAGAAGAGA

TCATCACTTATAGGAATTCCAGGAAGGTGAAATTCCCAATTGACTCCCTCCACAAAGGGGGTTTTCTAGGCTGTGTGGCACATGGCTGTCAGCCCATAGT

CTGAGCCATTGCCCCCAAGCTAGCTATATACTGAGGGAAGTGACCCTCCTGGGTTTGCTCAGATCTCTGATCGTTCCCCCCTCTGTGGCCCTTTTCTTTC

ACCCCTCCAGGAGAGCCACCCTGATATCATCCCACTGGCCTCCAACTGACCCACAATGTCCACAGTAACTTTCCCCCATTCTCACCCAGTATCCATAAAA

TAAAGAAATAATATTGCTTGTCT
Translation
MALFSAQSPYINP - UNI13416 - - UNI31623 - IIPFTGPIQGGLQEGLQVTLQGTTKSFAQR - UNI31623 - RFVVNFQNSFNGNDIA

FHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFK - UNI16143 - - UNI31623 - VMVNKKFFVQYQHRVPYHLVD

TIAVSGCLKLSFITFQ NSAAPVQHVFSTVQFSQPVQFPRTPKGRKQK - UNI28658 - TQNFRPAHQAPM - UNI21542 - AQTTIHMVHSTP

GQMFS - UNI29285 - TPGIPPVVYPTPAY TIPFYTPIPNGLYPSKSIMISGNVLPDATR RFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSW

GQEERSLLGRMPFSRGQSFS VWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT
Transcript ENSMUST00000108268
Sequence
AGGAAGAGAGCATTGGTTCCCCTGAGATAGAAGAGATGGCTCTCTTCAGTGCCCAGTCTCCATACATTAACCCG - UNI13416 - - UNI31623 -

 ATCATCCCCTTTACTGGACCAATCCAAGGAGGGCTGCAGGAGGGACTTCAGGTGACCCTCCAGGGGACTACCAAGAGTTTTGCACAAAG - UNI3162

3 - GTTTGTGGTGAACTTTCAGAACAGCTTCAATGGAAATGACATTGCCTTCCACTTCAACCCCCGGTTTGAGGAAGGAGGGTATGTGGTTTGCAACAC

GAAGCAGAACGGACAGTGGGGTCCTGAGGAGAGAAAGATGCAGATGCCCTTCCAGAAGGGGATGCCCTTTGAGCTTTGCTTCCTGGTGCAGAGGTCAGAG

TTCAAG - UNI16143 - - UNI31623 - GTGATGGTGAACAAGAAATTCTTTGTGCAGTACCAACACCGCGTACCCTACCACCTCGTGGACACCA

TCGCTGTCTCCGGCTGCTTGAAGCTGTCCTTTATCACCTTCCAG - UNI28658 - ACTCAGAACTTTCGTCCTGCCCACCAGGCACCCATG - UNI

21542 - GCTCAAACTACCATCCATATGGTTCACAGCACCCCTGGACAGATGTTCTCT - UNI29285 - ACTCCTGGAATCCCTCCTGTGGTGTAC

CCCACCCCAGCCTAT ACCATACCTTTCTACACCCCCATTCCAAATGGGCTTTACCCGTCCAAGTCCATCATGATATCAGGCAATGTCTTGCCAGATGCT

ACGAG GTTCCATATCAACCTTCGCTGTGGAGGTGACATTGCTTTCCACCTGAACCCCCGTTTCAATGAGAATGCTGTTGTCCGAAACACTCAGATCAAC

AACTCCTGGGGGCAGGAAGAGCGAAGTCTGCTTGGGAGGATGCCCTTCAGTCGAGGCCAGAGCTTCTCG GTGTGGATCATATGTGAAGGTCACTGCTTC

AAGGTAGCTGTGAATGGTCAACACATGTGTGAATATTACCACCGCCTGAAGAACTTGCAGGATATCAACACTCTAGAAGTGGCGGGTGATATCCAGCTGA

CCCACGTGCAGACATAGGCAAGGTCTCTGGCCTAGGGATAAGGGCTGGAGCACTCTGCCTGTGTCTTATCTTTCCCCTGTCTCAGCCCTGGCACCATCAG

AAGAGATCATCACTTATAGGAATTCCAGGAAGGTGAAATTCCCAATTGACTCCCTCCACAAAGGGGGTTTTCTAGGCTGTGTGGCACATGGCTGTCAGCC

CATAGTCTGAGCCATTGCCCCCAAGCTAGCTATATACTGAGGGAAGTGACCCTCCTGGGTTTGCTCAGATCTCTGATCGTTCCCCCCTCTGTGGCCCTTT

TCTTTCACCCCTCCAGGAGAGCCACCCTGATATCATCCCACTGGCCTCCAACTGACCCACAATGTCCACAGTAACTTTCCCCCATTCTCACCCAGTATCC

ATAAAATAAAGAAATAATATTGCTTGTCT
Translation
MALFSAQSPYINP - UNI13416 - - UNI31623 - IIPFTGPIQGGLQEGLQVTLQGTTKSFAQR - UNI31623 - RFVVNFQNSFNGNDIA

FHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFK - UNI16143 - - UNI31623 - VMVNKKFFVQYQHRVPYHLVD

TIAVSGCLKLSFITFQ - UNI28658 - TQNFRPAHQAPM - UNI21542 - AQTTIHMVHSTPGQMFS - UNI29285 - TPGIPPVVYPTPA

Y TIPFYTPIPNGLYPSKSIMISGNVLPDATR RFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFS VWIICEGHCFK

VAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT
Transcript ENSMUST00000073001
Sequence
CCTGAGATAGAAGAGATGGCTCTCTTCAGTGCCCAGTCTCCATACATTAACCCG - UNI13416 - - UNI31623 - ATCATCCCCTTTACTGGAC

CAATCCAAGGAGGGCTGCAGGAGGGACTTCAGGTGACCCTCCAGGGGACTACCAAGAGTTTTGCACAAAG - UNI31623 - GTTTGTGGTGAACTTT

CAGAACAGCTTCAATGGAAATGACATTGCCTTCCACTTCAACCCCCGGTTTGAGGAAGGAGGGTATGTGGTTTGCAACACGAAGCAGAACGGACAGTGGG

GTCCTGAGGAGAGAAAGATGCAGATGCCCTTCCAGAAGGGGATGCCCTTTGAGCTTTGCTTCCTGGTGCAGAGGTCAGAGTTCAAG - UNI16143 - 

- UNI31623 - GTGATGGTGAACAAGAAATTCTTTGTGCAGTACCAACACCGCGTACCCTACCACCTCGTGGACACCATCGCTGTCTCCGGCTGCTTG

AAGCTGTCCTTTATCACCTTCCAG TCTGCAGCCCCTGTCCAGCATGTCTTCTCCACAGTGCAGTTCTCTCAGCCAGTCCAGTTCCCACGGACCCCTAAG

GGGCGCAAACAGAAA - UNI28658 - ACTCAGAACTTTCGTCCTGCCCACCAGGCACCCATG - UNI21542 - GCTCAAACTACCATCCATATG

GTTCACAGCACCCCTGGACAGATGTTCTCT - UNI29285 - ACTCCTGGAATCCCTCCTGTGGTGTACCCCACCCCAGCCTAT ACCATACCTTTCT

ACACCCCCATTCCAAATGGGCTTTACCCGTCCAAGTCCATCATGATATCAGGCAATGTCTTGCCAGATGCTACGAG GTTCCATATCAACCTTCGCTGTG

GAGGTGACATTGCTTTCCACCTGAACCCCCGTTTCAATGAGAATGCTGTTGTCCGAAACACTCAGATCAACAACTCCTGGGGGCAGGAAGAGCGAAGTCT

GCTTGGGAGGATGCCCTTCAGTCGAGGCCAGAGCTTCTCG GTGTGGATCATATGTGAAGGTCACTGCTTCAAGGTAGCTGTGAATGGTCAACACATGTG

TGAATATTACCACCGCCTGAAGAACTTGCAGGATATCAACACTCTAGAAGTGGCGGGTGATATCCAGCTGACCCACGTGCAGACATAG
Translation
MALFSAQSPYINP - UNI13416 - - UNI31623 - IIPFTGPIQGGLQEGLQVTLQGTTKSFAQR - UNI31623 - RFVVNFQNSFNGNDIA

FHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFK - UNI16143 - - UNI31623 - VMVNKKFFVQYQHRVPYHLVD

TIAVSGCLKLSFITFQ SAAPVQHVFSTVQFSQPVQFPRTPKGRKQK - UNI28658 - TQNFRPAHQAPM - UNI21542 - AQTTIHMVHSTPG

QMFS - UNI29285 - TPGIPPVVYPTPAY TIPFYTPIPNGLYPSKSIMISGNVLPDATR RFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWG

QEERSLLGRMPFSRGQSFS VWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT

For any suggestions or comments, please send an email to unitrap@crg.es