Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001173 (Ocrl)
Chromosomal location
Chr X: 45265615 - 45319041 (+)
Description
oculocerebrorenal syndrome of Lowe Gene [Source:MGI (curated);Acc:Ocrl-001]
RefSeq_dna
NM_177215 
RefSeq_peptide
NP_796189.2 
UniGene
Mm.404913 Mm.472553 Mm.410425 Mm.210343 
MGI
MGI:109589 
Uniprot/SPTREMBL
Q7TPR1 B1AVT5 Q8BXC9 Q8BXT3 Q6NVF0 Q80XM6 
Human Ortholog
ENSG00000122126 (OCRL)
Omim 300555 - DENT DISEASE 2  309000 - LOWE OCULOCEREBRORENAL SYNDROME  
UniTrap UNI2210
Vector Insertion
Chr X: 45291588 - 45294285
Public Clones XR0380 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18599
Vector Insertion
Chr X: 45315385 - 45316317
Public Clones not available
Private Clones OST419938 (lexicon) OST327176 (lexicon) OST277609 (lexicon)
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115013
Sequence
GGGGACTTTTAGGATAGCATTGGAAATGTAGATGAGGAAAATACCTAATAAAAAAATTTAAAAAAAGAGACAAAGATCACATTGTATCCACTCGAGAAGG

TTTTGAAGGAGATGTAATGCTTTCTTCTGAGGCCCTTTGATTCTAATCCCTTTTCATCTGTTAGGAGAAATCCCTTCTGCAGATGGTACCCTTGGATGAA

GGTACCAGTGAGCGACCCCTTCAAGTCCCCAAAGAGATCTGGCTTCTAGTAGATCACTTGTTCAAATATGCATGTCACCAG GAGGACTTGTTCCAAACC

CCTGGAATGCAGGAGGAGTTACAGCAGATCATTGATTGCCTGGATACCAGCATTCCTGAGACAATTC CTGGCAATAACCATTCTGTGGCTGAAGCACTG

CTCATTTTCCTGGAAGCTCTGCCAGAGCCAGTCATCTGTTATGAGCTGTATCAGCGATGTCTTGACTCTGCTCATGATCCTCGGATCTGCAAACAG - U

NI18599 - GTCATTTCCCAGCTTCCAAGGTGCCATAGAAATGTTTTCCGCTACTTGATGGCATTCCTTCGTGAACTCTTAAAATTCTCTGACTACAAC

AATATCAACACCAACATGATTG CTACCCTGTTCAGTAGCCTTCTCCTAAGACCTCCACCAAACCTCATGACAAGACAGACTCCAAATGACCGCCAGCAT

GCCATCCAGTTCCTCTTGGTCTTCCTGCTTGGGAACGAGGAAGACTAAGTCTTTTCCTATCCGAGATTCTAGAGGAGGAAGACCTTGGGCTCCGACTACT

TCAAAATGATCTGAAAAGTTATCACACAAAAAGGGTCTACTGTAGGATCTTACATTCTGTTAGTAGTACAAAGGGAAGAGTTTTCCTAATCCTTCCTTAC

CATATCCTACACAGCAAAATCCTTTTAGACATATATTGCCAAGCCAAAGTTACCATATTTCGGTGTTTTTGTGTTTACTCTTTGTAAAGCAAAGAGGTCT

GTATTTACACACCTTTACCTAGGGGTATGTTTTCTGCCCTGCTTCCCAGTCCTCATGATTATCTTTAATACCCTAGGCCTGGATTGAGAGGCCTTCCTGT

TCTAAGCCTACAAGTACTACTTGCTATAGCTCAGACTTGTCTACAGTTCTTTGTATGATGCACTTTGGACCCACCCTCTCCTCATGTCACTACTTTGCAC

ACTTCCTCCATGCTCTCACTTTGAAGGAAGCCTGGATGAGGCTAGTGACTCTGTGGGTGTCCTGAACAGTGAAGTTCACTGTCTCCATGTGATTGTTACA

AGCGTTTGTGCAGTTCTACTACAATGATATCTGTATGTCACTGTAATGTTGGCCTTCGTGGGGAACCACACTTGGTGGAGCCCGATTCCCTTGTCTCAGA

CCATGGTTAGTTACATAATTTTATGGACTATAGAGATGGCGTCCCACTGATGTGAGAAACATCACAACAGCGAGGAAAGCACTGTGAGTATATCAGAATG

AAAACATCCCTGCTTCCCAGTCCCCGTGCCCGGCTACTATCCACACTTGACATGCGGAGCAATCCTGCATGTTGGTCCCCATCTCCCCCACTAGAAACCC

ACTTCCAGAGTCATGTTTGCATCACAGTCAAAAGAGAAGTCTGTGCACCTCAAGTGAGGTCCCAGGAGCTTTCCTCGCCCTCCAAACCAAGCATTGAGGG

TAACCCTCAGAACCCATTCTCCTATCTCCTAAAGTGTCGGGGAAAGTTACTGGCCTCTCTCAACAGGGCTCACTCTGAGCTCCACATCCGCCTCCTTCAA

GCAAAGACTTAAAAAGACTGCCCTTGACTCCTTGACACTATATCAAGTGCTGTGTAAGAGAGACTGGTCCGTGGGACCAGCCACACACATTACCTCTTCC

ACTTGAAATGACTCTAAGGTTTTCATTTTATTCAAGCTTTGTGGGACAGACAAACTTTTTAAAAATTACTTTGTTGACTGACAAACCAGCTGCCAGCTTC

TGGCTGCAAAACTGCCTGGTGAAATTGACTTGCTTGGTTTCATTCACCAAACCAACCCAAGTCGTGTCATTCTTGCCTATTAACATCTGATGTAAGGCGC

TCATATAGGCTGTGTGTACAATCTTGGGCACTGATTCCATCAGTAGTATCTTGTACCATCCAAGGAGAGGGCCAGGAAAACATCCACCATCAAATGGTTT

TCCAGCTCCCTCATCTCTTCAAAATTGAGTTCTTGGGAGAACAAAAGGTATGTATCCTGCAGTAGTTAAGCCCTTAAATAATTGGGAGTTGGGAAATCGG

AATCAAAGTATTGGTGCCAGCTCACTGAAGATCTGATTGGGTCAACAGTTGATTAGTGGAAGACGGAGAGCAGAAGAATTTTGTCATATCTATTAGGCCA

GAAAGTAATCACTGAAGAAGCAGATGGTAGGAGCTGGAGCAAGGTGGTCCACAGGGGAATGCCTCTCCTGTGCCCATTTTATAATACCTCGCCAAGCTTG

GGTCTTTAGATGAGCAAGATTATGGTTAGTGGGGGCTCTGTGGAGCATGCACGTAGTGCCCTTCCTTCATCAGGCCAAAGCACCAAGTTGCTTCACTGCC

TCGGCCTTTTGTCCAGCTCAGCCTGGGATGTCTATAGGGTTGAGGGTTTTAGACAATCTCTAGGAAAGGGATACAAAACAGATCCGATGGAAGAAACCTA

CTTCCCTATCCTGCCTATCCTGCCCCTCAACCTCTTCATTCCTAATTCCTCCAAGGTACTATTTCATAGTTGCTCTGAATTAAGGATTTCAGGTTTAACT

GGTAGTGAAAGACTGCACCTAGCATCTTCGGGAAGAAATGATTCCAGTCTATTGGCTGATACTACATTAGTTTCCCTTTCTGATTCTTAATCTGTAGTTC

TTTGTTATATTTCACAAAAAAAAAAAA
Translation
MVPLDEGTSERPLQVPKEIWLLVDHLFKYACHQ EDLFQTPGMQEELQQIIDCLDTSIPETIP PGNNHSVAEALLIFLEALPEPVICYELYQRCLDSAH

DPRICKQ - UNI18599 - VISQLPRCHRNVFRYLMAFLRELLKFSDYNNINTNMIA ATLFSSLLLRPPPNLMTRQTPNDRQHAIQFLLVFLLGNEE

D
Transcript ENSMUST00000115015
Sequence
GTCTCTCTCCTCCCGGCTCTAAAGCTCCCCGGCTGGCTCCCGGGCTCCCGGGTTCCCGGGCTCCCGGGCTTCCAGGCTCCCAGCGCTGGAGCCCTTCCTC

TCCGCCTAGGCGAGGCAGGCCGGCGGCAGGCCGCAGGAGGTGGTGTCGTGGAATCCGCTGGCAGTCCGCAGCCCCGCAGAGCCTGGAGGCCGCCCTGATG

GAGCCGCGGCTCCCGATTGGAGCTCAGCCCCTGGCA ATGGTGGCGGGTTTGGAGATGAAGGGTCCCCTCCGGGAACCCTGCGTCCTGACCCTAGCCCGG

AGGAATGGGCAGTATGA GTTAATAATCCAGTTGCATGGAAAGGAACAACATGTTCAAGATATCATTCCTATAAATAGCCACTTCAGATGTGTTCAAG A

AGCAGAAGAAACTCTTTTGATTGATATTGCTTCAAACA GTGGCTGCAAAATTCGGGTACAGGGAGACTGGACCAGAGAGCGCCACTTTGAAATTCCTGA

TGAAGAACGCTGTTTGAAGTTCCTCTCAGAGGTCCTCGAAGCTCAGGAAG CTCAGTCACAGCTTCTTGTTCCAGAACAAAAAGACTCATCTAGCTGGTA

CCAGAAATTAGACACTATGGATAAACCTGCTTATTCAG GGCTGCTTGGATTTGAGGATAATTTTTCATCTCTGGATTTAGATAAGAAAATGAATACACA

AAATCCCCGATCAGGGAGTCATCGGGAACCACCCCCTCCACCTTCTTCATCGACTAGAAT GCTTTCGCGTGAAAAGGAAGCTTCAAACAAAGAACAGCC

CAAAGTGACCAATACCATGCGGAAGCTATTTGTCCCGAACACCCAAACCGGGCAGCGAGAGGGTCTCATTAAACATATCCTCACAAAGCGAGAGAAAGAA

TATGTCAACATCCAGTCTTTCAG GTTTTTTGTTGGAACTTGGAATGTGAACGGCCAGTCTCCAGACAGCAGCTTAGAACCTTGGCTCGACTGTGATCCA

AATCCTCCTGATATTTACTGCATTGG ATTCCAAGAGCTGGACTTGAGCACCGAAGCCTTTTTCTACTTCGAGTCTGTGAAAGAGCAAGAGTGGTCCTTG

GCTGTGGAAAGGGGGCTGCCTTCGAAGGCCAAGTATAGAAAA GTTCAACTGGTCCGCCTTGTGGGGATGATGCTTCTTATATTTGCCAGAAAAGATCAG

TGTCAATACATCCGAGATGTTGCTACAGAAACAACTGGAACTGGAATCATGGGGAAAATG GGAAACAAAGGTGGGGTAGCTGTAAGATTTGTATTCCAC

AACACCACTTTCTGCATTGTCAATTCGCACCTGGCCGCCCACGTGGAAGAGTTCGAACGAAGGAATCAGGATTATAAAGACATCTGTGCAAGAATGACTT

TTTCAGTCCCCAATCAGACTGTCCCGCAAGTGAACATCATGAAGCATGA TGTTGTCATTTGGCTGGGAGACTTGAACTACAGACTTTGCATGCCTGATG

CCAGTGAGGTGAAAAGTCTTATTAATAAAAATGAGCTTCATAAGCTGTTGAAATTTGACCAG - UNI2210 - TTAAACATTCAGCGCACACAGAAAA

AAGCTTTTGCGGATTTCAATGAAGGGGAAATTAATTTCGTTCCCACGTACAAATATGATTCGAAAACTGACAGATGGGATTCCAG TGGGAAATGCCGAG

TTCCCGCCTGGTGTGACCGAATTCTTTGGAGAGGAATAAATGTTAATCAACTTCATTACCGGAGTCACATGGAACTCAAAACTAGTGACCACAAACCTGT

TAGCGCCCTGTTCCATATTGGG ACACACCAGAAGAGGCCGTCGGATCCCATTACAGATGGTTGTGAGCCACCATGTGGTTGCTGGGAATTGAACTCAGG

ACCTCTGGAAGAGCAGTCAGTGCTCTTAACCGCTGAGCCATCTCTCCAGCCCTCACCCATGTATCTTATG GTGAAGGTTGTGGATGAGCGGAGGTATCG

GAAGGTCTTTGAAGATATCGTCCGCATTATGGACAGAATGGAAAACGACTTCCTTCCTTCATTAGAACTTAGCAGGAGAGAG TTTTTTTTTGAGAATGT

GAAGTTTCGGCAGCTGCAAAAGGAGAAGTTCCAGATCAGCAACAATGGACAGGTTCCCTGCCATTTTTCTTTCATCCCTAAGCTTAATGACAGCCAATAC

TGCAAGCCATGGCTTCGAGCTGAACCTTTTGAGGGCTACTTGGAGCCAA ACGAGACCTTAGACATCTCCCTTGATGTATACGTCAGCAAAGACTCTGTA

ACCATCCTGAACTCCGGTGAAGATAAGATTGAAGATATTCTTGTCCTCCATTTGGATCGAGGCAAAGATTACTTCTTGACCATCGGTGGGAATTACCTCC

CAAGTTGCTTTGGAACCTCATTGGAGGCTTTGTGCCGAATGAAAAGACCAATTCGAGAAGTTCCTGTCACCAAACTCATAGACCTG GAAGAAGACAGCT

ACCTAGAAAAG GAGAAATCCCTTCTGCAGATGGTACCCTTGGATGAAGGTACCAGTGAGCGACCCCTTCAAGTCCCCAAAGAGATCTGGCTTCTAGTAG

ATCACTTGTTCAAATATGCATGTCACCAG GAGGACTTGTTCCAAACCCCTGGAATGCAGGAGGAGTTACAGCAGATCATTGATTGCCTGGATACCAGCA

TTCCTGAGACAATTC CTGGCAATAACCATTCTGTGGCTGAAGCACTGCTCATTTTCCTGGAAGCTCTGCCAGAGCCAGTCATCTGTTATGAGCTGTATC

AGCGATGTCTTGACTCTGCTCATGATCCTCGGATCTGCAAACAG - UNI18599 - GTCATTTCCCAGCTTCCAAGGTGCCATAGAAATGTTTTCCGC

TACTTGATGGCATTCCTTCGTGAACTCTTAAAATTCTCTGACTACAACAATATCAACACCAACATGATTG CTACCCTGTTCAGTAGCCTTCTCCTAAGA

CCTCCACCAAACCTCATGACAAGACAGACTCCAAATGACCGCCAGCATGCCATCCAGTTCCTCTTGGTCTTCCTGCTTGGGAACGAGGAAGACTAAGTCT

TTTCCTATCCGAGATTCTAGAGGAGGAAGACCTTGGGCTCCGACTACTTCAAAATGATCTGAAAAGTTATCACACAAAAAGGGTCTACTGTAGGATCTTA

CATTCTGTTAGTAGTACAAAGGGAAGAGTTTTCCTAATCCTTCCTTACCATATCCTACACAGCAAAATCCTTTTAGACATATATTGCCAAGCCAAAGTTA

CCATATTTCGGTGTTTTTGTGTTTACTCTTTGTAAAGCAAAGAGGTCTGTATTTACACACCTTTACCTAGGGGTATGTTTTCTGCCCTGCTTCCCAGTCC

TCATGATTATCTTTAATACCCTAGGCCTGGATTGAGAGGCCTTCCTGTTCTAAGCCTACAAGTACTACTTGCTATAGCTCAGACTTGTCTACAGTTCTTT

GTATGATGCACTTTGGACCCACCCTCTCCTCATGTCACTACTTTGCACACTTCCTCCATGCTCTCACTTTGAAGGAAGCCTGGATGAGGCTAGTGACTCT

GTGGGTGTCCTGAACAGTGAAGTTCACTGTCTCCATGTGATTGTTACAAGCGTTTGTGCAGTTCTACTACAATGATATCTGTATGTCACTGTAATGTTGG

CCTTCGTGGGGAACCACACTTGGTGGAGCCCGATTCCCTTGTCTCAGACCATGGTTAGTTACATAATTTTATGGACTATAGAGATGGCGTCCCACTGATG

TGAGAAACATCACAACAGCGAGGAAAGCACTGTGAGTATATCAGAATGAAAACATCCCTGCTTCCCAGTCCCCGTGCCCGGCTACTATCCACACTTGACA

TGCGGAGCAATCCTGCATGTTGGTCCCCATCTCCCCCACTAGAAACCCACTTCCAGAGTCATGTTTGCATCACAGTCAAAAGAGAAGTCTGTGCACCTCA

AGTGAGGTCCCAGGAGCTTTCCTCGCCCTCCAAACCAAGCATTGAGGGTAACCCTCAGAACCCATTCTCCTATCTCCTAAAGTGTCGGGGAAAGTTACTG

GCCTCTCTCAACAGGGCTCACTCTGAGCTCCACATCCGCCTCCTTCAAGCAAAGACTTAAAAAGACTGCCCTTGACTCCTTGACACTATATCAAGTGCTG

TGTAAGAGAGACTGGTCCGTGGGACCAGCCACACACATTACCTCTTCCACTTGAAATGACTCTAAGGTTTTCATTTTATTCAAGCTTTGTGGGACAGACA

AACTTTTTAAAAATTACTTTGTTGACTGACAAACCAGCTGCCAGCTTCTGGCTGCAAAACTGCCTGGTGAAATTGACTTGCTTGGTTTCATTCACCAAAC

CAACCCAAGTCGTGTCATTCTTGCCTATTAACATCTGATGTAAGGCGCTCATATAGGCTGTGTGTACAATCTTGGGCACTGATTCCATCAGTAGTATCTT

GTACCATCCAAGGAGAGGGCCAGGAAAACATCCACCATCAAATGGTTTTCCAGCTCCCTCATCTCTTCAAAATTGAGTTCTTGGGAGAACAAAAGGTATG

TATCCTGCAGTAGTTAAGCCCTTAAATAATTGGGAGTTGGGAAATCGGAATCAAAGTATTGGTGCCAGCTCACTGAAGATCTGATTGGGTCAACAGTTGA

TTAGTGGAAGACGGAGAGCAGAAGAATTTTGTCATATCTATTAGGCCAGAAAGTAATCACTGAAGAAGCAGATGGTAGGAGCTGGAGCAAGGTGGTCCAC

AGGGGAATGCCTCTCCTGTGCCCATTTTATAATACCTCGCCAAGCTTGGGTCTTTAGATGAGCAAGATTATGGTTAGTGGGGGCTCTGTGGAGCATGCAC

GTAGTGCCCTTCCTTCATCAGGCCAAAGCACCAAGTTGCTTCACTGCCTCGGCCTTTTGTCCAGCTCAGCCTGGGATGTCTATAGGGTTGAGGGTTTTAG

ACAATCTCTAGGAAAGGGATACAAAACAGATCCGATGGAAGAAACCTACTTCCCTATCCTGCCTATCCTGCCCCTCAACCTCTTCATTCCTAATTCCTCC

AAGGTACTATTTCATAGTTGCTCTGAATTAAGGATTTCAGGTTTAACTGGTAGTGAAAGACTGCACCTAGCATCTTCGGGAAGAAATGATTCCAGTCTAT

TGGCTGATACTACATTAGTTTCCCTTTCTGATTCTTAATCTGTAGTTCTTTGTTATATTTCACAAAAAAAAAAAATGTCTCGGTCACTACGCAAAGCTGC

TAGTGGGGTTCTGTATTTTGTGTCATCTTTTTTATTATAATTTATTGCAATTTTATGAATAAATATATGTTGTGTG
Translation
            MPDASEVKSLINKNELHKLLKFDQ - UNI2210 - LNIQRTQKKAFADFNEGEINFVPTYKYDSKTDRWDSS SGKCRVPAWCDRI

LWRGINVNQLHYRSHMELKTSDHKPVSALFHIG THQKRPSDPITDGCEPPCGCWELNSGPLEEQSVLLTAEPSLQPSPMYLM VKVVDERRYRKVFEDI

VRIMDRMENDFLPSLELSRRE FFFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPN NETLDISLDVYVSKDSVTILN

SGEDKIEDILVLHLDR     - UNI18599 -  
Transcript ENSMUST00000115020
Sequence
GCTCTCTCTCTCTGGTCAGTCTCTCTCCTCCCGGCTCTAAAGCTCCCCGGCTGGCTCCCGGGCTCCCGGGTTCCCGGGCTCCCGGGCTTCCAGGCTCCCA

GCGCTGGAGCCCTTCCTCTCCGCCTAGGCGAGGCAGGCCGGCGGCAGGCCGCAGGAGGTGGTGTCGTGGAATCCGCTGGCAGTCCGCAGCCCCGCAGAGC

CTGGAGGCCGCCCTGATGGAGCCGCGGCTCCCGATTGGAGCTCAGCCCCTGGCA ATGGTGGCGGGTTTGGAGATGAAGGGTCCCCTCCGGGAACCCTGC

GTCCTGACCCTAGCCCGGAGGAATGGGCAGTATGA GTTAATAATCCAGTTGCATGGAAAGGAACAACATGTTCAAGATATCATTCCTATAAATAGCCAC

TTCAGATGTGTTCAAG AAGCAGAAGAAACTCTTTTGATTGATATTGCTTCAAACA GTGGCTGCAAAATTCGGGTACAGGGAGACTGGACCAGAGAGCG

CCACTTTGAAATTCCTGATGAAGAACGCTGTTTGAAGTTCCTCTCAGAGGTCCTCGAAGCTCAGGAAG CTCAGTCACAGCTTCTTGTTCCAGAACAAAA

AGACTCATCTAGCTGGTACCAGAAATTAGACACTATGGATAAACCTGCTTATTCAG GGCTGCTTGGATTTGAGGATAATTTTTCATCTCTGGATTTAGA

TAAGAAAATGAATACACAAAATCCCCGATCAGGGAGTCATCGGGAACCACCCCCTCCACCTTCTTCATCGACTAGAAT GCTTTCGCGTGAAAAGGAAGC

TTCAAACAAAGAACAGCCCAAAGTGACCAATACCATGCGGAAGCTATTTGTCCCGAACACCCAAACCGGGCAGCGAGAGGGTCTCATTAAACATATCCTC

ACAAAGCGAGAGAAAGAATATGTCAACATCCAGTCTTTCAG GTTTTTTGTTGGAACTTGGAATGTGAACGGCCAGTCTCCAGACAGCAGCTTAGAACCT

TGGCTCGACTGTGATCCAAATCCTCCTGATATTTACTGCATTGG ATTCCAAGAGCTGGACTTGAGCACCGAAGCCTTTTTCTACTTCGAGTCTGTGAAA

GAGCAAGAGTGGTCCTTGGCTGTGGAAAGGGGGCTGCCTTCGAAGGCCAAGTATAGAAAA GTTCAACTGGTCCGCCTTGTGGGGATGATGCTTCTTATA

TTTGCCAGAAAAGATCAGTGTCAATACATCCGAGATGTTGCTACAGAAACAACTGGAACTGGAATCATGGGGAAAATG GGAAACAAAGGTGGGGTAGCT

GTAAGATTTGTATTCCACAACACCACTTTCTGCATTGTCAATTCGCACCTGGCCGCCCACGTGGAAGAGTTCGAACGAAGGAATCAGGATTATAAAGACA

TCTGTGCAAGAATGACTTTTTCAGTCCCCAATCAGACTGTCCCGCAAGTGAACATCATGAAGCATGA TGTTGTCATTTGGCTGGGAGACTTGAACTACA

GACTTTGCATGCCTGATGCCAGTGAGGTGAAAAGTCTTATTAATAAAAATGAGCTTCATAAGCTGTTGAAATTTGACCAG - UNI2210 - TTAAACA

TTCAGCGCACACAGAAAAAAGCTTTTGCGGATTTCAATGAAGGGGAAATTAATTTCGTTCCCACGTACAAATATGATTCGAAAACTGACAGATGGGATTC

CAG TGGGAAATGCCGAGTTCCCGCCTGGTGTGACCGAATTCTTTGGAGAGGAATAAATGTTAATCAACTTCATTACCGGAGTCACATGGAACTCAAAAC

TAGTGACCACAAACCTGTTAGCGCCCTGTTCCATATTGGG GTGAAGGTTGTGGATGAGCGGAGGTATCGGAAGGTCTTTGAAGATATCGTCCGCATTAT

GGACAGAATGGAAAACGACTTCCTTCCTTCATTAGAACTTAGCAGGAGAGAG TTTTTTTTTGAGAATGTGAAGTTTCGGCAGCTGCAAAAGGAGAAGTT

CCAGATCAGCAACAATGGACAGGTTCCCTGCCATTTTTCTTTCATCCCTAAGCTTAATGACAGCCAATACTGCAAGCCATGGCTTCGAGCTGAACCTTTT

GAGGGCTACTTGGAGCCAA ACGAGACCTTAGACATCTCCCTTGATGTATACGTCAGCAAAGACTCTGTAACCATCCTGAACTCCGGTGAAGATAAGATT

GAAGATATTCTTGTCCTCCATTTGGATCGAGGCAAAGATTACTTCTTGACCATCGGTGGGAATTACCTCCCAAGTTGCTTTGGAACCTCATTGGAGGCTT

TGTGCCGAATGAAAAGACCAATTCGAGAAGTTCCTGTCACCAAACTCATAGACCTG GAAGAAGACAGCTACCTAGAAAAGGTAATTCAATCCATTGGTG

GTAATGAAGGTTTCCTTGTGCTTGATTAACACTTAACTGTGGTCCCTGGAAATTGTCCCTAAGCATTCTCATATCAGAGGCCTCTGACTCGGTGAGAATT

TCCTAATAACCACTGATGTCCTGCAAGGTATCTTGAAGTATGCTCAAAATATAGGAACAACATCGACACATCTGAGACGTTATTGATACTCTGTATGTAG

AAGAAATAAAACTCAAGGGTCTATTTTCTTTTTCTTTTTGAGACAGGATCTCATGTACTATAGGCTAGCCTCACTAGGTAGCAAAGAGTGACCTTAATTT

TTTTCATCCTCCTGTCTCTACCTCCCCAGTGCTGAGATTACAGCACCCCTGGTTTTACTCAGTCCTGAGAATCAAACTTGGTCCTTGTGATAGATGATAG

ATAAGCATTCTTACAACTGCTATATCCCTAGCTACTAGTATGTGTGCATGCATGTTTGCATGCTTTTGCACACTAAATTATGCTGCAAGGGATAAAACAC

AGGGCCTTACACATGCTAGACAAACACACTACCCACACCACTTTGTATTTTTTAATTTGCAGACAAGTGCTGCACTATGAAACTACATCTCTAGCCCAGA

TTTGTCTTGATAAATCTTATCTGAAAACTCATGAGTTGGTAGTAAAACCAAAAAATAATTTTTTTGGTTATTCCTGTTACATTAAAAGTAATTTGGAGCT

CCTAGCGTCCATGAATTCGTGGTGCCACTTGCATGTTCAGGTTCCACTGGATATTACCACCACCTCTCCCACAAGAATGGCAGGGTTTGTGTGTCCTCTT

TTCTCAAATAAAATGATTTAACTAAAAAACAAAACAAAAC
Translation
MEPRLPIGAQPLA MVAGLEMKGPLREPCVLTLARRNGQYE ELIIQLHGKEQHVQDIIPINSHFRCVQE EAEETLLIDIASNS SGCKIRVQGDWTRE

RHFEIPDEERCLKFLSEVLEAQEA AQSQLLVPEQKDSSSWYQKLDTMDKPAYSG GLLGFEDNFSSLDLDKKMNTQNPRSGSHREPPPPPSSSTRM ML

SREKEASNKEQPKVTNTMRKLFVPNTQTGQREGLIKHILTKREKEYVNIQSFR RFFVGTWNVNGQSPDSSLEPWLDCDPNPPDIYCIG GFQELDLSTE

AFFYFESVKEQEWSLAVERGLPSKAKYRK VQLVRLVGMMLLIFARKDQCQYIRDVATETTGTGIMGKM GNKGGVAVRFVFHNTTFCIVNSHLAAHVEE

FERRNQDYKDICARMTFSVPNQTVPQVNIMKHD DVVIWLGDLNYRLCMPDASEVKSLINKNELHKLLKFDQ - UNI2210 - LNIQRTQKKAFADFN

EGEINFVPTYKYDSKTDRWDSS SGKCRVPAWCDRILWRGINVNQLHYRSHMELKTSDHKPVSALFHIG VKVVDERRYRKVFEDIVRIMDRMENDFLPS

LELSRRE FFFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPN NETLDISLDVYVSKDSVTILNSGEDKIEDILVLHL

DRGKDYFLTIGGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDL EEDSYLEKVIQSIGGNEGFLVLD
Transcript ENSMUST00000001202
Sequence
GTCTCTCTCCTCCCGGCTCTAAAGCTCCCCGGCTGGCTCCCGGGCTCCCGGGTTCCCGGGCTCCCGGGCTTCCAGGCTCCCAGCGCTGGAGCCCTTCCTC

TCCGCCTAGGCGAGGCAGGCCGGCGGCAGGCCGCAGGAGGTGGTGTCGTGGAATCCGCTGGCAGTCCGCAGCCCCGCAGAGCCTGGAGGCCGCCCTGATG

GAGCCGCGGCTCCCGATTGGAGCTCAGCCCCTGGCA ATGGTGGCGGGTTTGGAGATGAAGGGTCCCCTCCGGGAACCCTGCGTCCTGACCCTAGCCCGG

AGGAATGGGCAGTATGA GTTAATAATCCAGTTGCATGGAAAGGAACAACATGTTCAAGATATCATTCCTATAAATAGCCACTTCAGATGTGTTCAAG A

AGCAGAAGAAACTCTTTTGATTGATATTGCTTCAAACA GTGGCTGCAAAATTCGGGTACAGGGAGACTGGACCAGAGAGCGCCACTTTGAAATTCCTGA

TGAAGAACGCTGTTTGAAGTTCCTCTCAGAGGTCCTCGAAGCTCAGGAAG CTCAGTCACAGCTTCTTGTTCCAGAACAAAAAGACTCATCTAGCTGGTA

CCAGAAATTAGACACTATGGATAAACCTGCTTATTCAG GGCTGCTTGGATTTGAGGATAATTTTTCATCTCTGGATTTAGATAAGAAAATGAATACACA

AAATCCCCGATCAGGGAGTCATCGGGAACCACCCCCTCCACCTTCTTCATCGACTAGAAT GCTTTCGCGTGAAAAGGAAGCTTCAAACAAAGAACAGCC

CAAAGTGACCAATACCATGCGGAAGCTATTTGTCCCGAACACCCAAACCGGGCAGCGAGAGGGTCTCATTAAACATATCCTCACAAAGCGAGAGAAAGAA

TATGTCAACATCCAGTCTTTCAG GTTTTTTGTTGGAACTTGGAATGTGAACGGCCAGTCTCCAGACAGCAGCTTAGAACCTTGGCTCGACTGTGATCCA

AATCCTCCTGATATTTACTGCATTGG ATTCCAAGAGCTGGACTTGAGCACCGAAGCCTTTTTCTACTTCGAGTCTGTGAAAGAGCAAGAGTGGTCCTTG

GCTGTGGAAAGGGGGCTGCCTTCGAAGGCCAAGTATAGAAAA GTTCAACTGGTCCGCCTTGTGGGGATGATGCTTCTTATATTTGCCAGAAAAGATCAG

TGTCAATACATCCGAGATGTTGCTACAGAAACAACTGGAACTGGAATCATGGGGAAAATG GGAAACAAAGGTGGGGTAGCTGTAAGATTTGTATTCCAC

AACACCACTTTCTGCATTGTCAATTCGCACCTGGCCGCCCACGTGGAAGAGTTCGAACGAAGGAATCAGGATTATAAAGACATCTGTGCAAGAATGACTT

TTTCAGTCCCCAATCAGACTGTCCCGCAAGTGAACATCATGAAGCATGA TGTTGTCATTTGGCTGGGAGACTTGAACTACAGACTTTGCATGCCTGATG

CCAGTGAGGTGAAAAGTCTTATTAATAAAAATGAGCTTCATAAGCTGTTGAAATTTGACCAG - UNI2210 - TTAAACATTCAGCGCACACAGAAAA

AAGCTTTTGCGGATTTCAATGAAGGGGAAATTAATTTCGTTCCCACGTACAAATATGATTCGAAAACTGACAGATGGGATTCCAG TGGGAAATGCCGAG

TTCCCGCCTGGTGTGACCGAATTCTTTGGAGAGGAATAAATGTTAATCAACTTCATTACCGGAGTCACATGGAACTCAAAACTAGTGACCACAAACCTGT

TAGCGCCCTGTTCCATATTGGG GTGAAGGTTGTGGATGAGCGGAGGTATCGGAAGGTCTTTGAAGATATCGTCCGCATTATGGACAGAATGGAAAACGA

CTTCCTTCCTTCATTAGAACTTAGCAGGAGAGAG TTTTTTTTTGAGAATGTGAAGTTTCGGCAGCTGCAAAAGGAGAAGTTCCAGATCAGCAACAATGG

ACAGGTTCCCTGCCATTTTTCTTTCATCCCTAAGCTTAATGACAGCCAATACTGCAAGCCATGGCTTCGAGCTGAACCTTTTGAGGGCTACTTGGAGCCA

A ACGAGACCTTAGACATCTCCCTTGATGTATACGTCAGCAAAGACTCTGTAACCATCCTGAACTCCGGTGAAGATAAGATTGAAGATATTCTTGTCCTC

CATTTGGATCGAGGCAAAGATTACTTCTTGACCATCGGTGGGAATTACCTCCCAAGTTGCTTTGGAACCTCATTGGAGGCTTTGTGCCGAATGAAAAGAC

CAATTCGAGAAGTTCCTGTCACCAAACTCATAGACCTG GAAGAAGACAGCTACCTAGAAAAG GAGAAATCCCTTCTGCAGATGGTACCCTTGGATGAA

GGTACCAGTGAGCGACCCCTTCAAGTCCCCAAAGAGATCTGGCTTCTAGTAGATCACTTGTTCAAATATGCATGTCACCAG GAGGACTTGTTCCAAACC

CCTGGAATGCAGGAGGAGTTACAGCAGATCATTGATTGCCTGGATACCAGCATTCCTGAGACAATTC CTGGCAATAACCATTCTGTGGCTGAAGCACTG

CTCATTTTCCTGGAAGCTCTGCCAGAGCCAGTCATCTGTTATGAGCTGTATCAGCGATGTCTTGACTCTGCTCATGATCCTCGGATCTGCAAACAG - U

NI18599 - GTCATTTCCCAGCTTCCAAGGTGCCATAGAAATGTTTTCCGCTACTTGATGGCATTCCTTCGTGAACTCTTAAAATTCTCTGACTACAAC

AATATCAACACCAACATGATTG CTACCCTGTTCAGTAGCCTTCTCCTAAGACCTCCACCAAACCTCATGACAAGACAGACTCCAAATGACCGCCAGCAT

GCCATCCAGTTCCTCTTGGTCTTCCTGCTTGGGAACGAGGAAGACTAAGTCTTTTCCTATCCGAGATTCTAGAGGAGGAAGACCTTGGGCTCCGACTACT

TCAAAATGATCTGAAAAGTTATCACACAAAAAGGGTCTACTGTAGGATCTTACATTCTGTTAGTAGTACAAAGGGAAGAGTTTTCCTAATCCTTCCTTAC

CATATCCTACACAGCAAAATCCTTTTAGACATATATTGCCAAGCCAAAGTTACCATATTTCGGTGTTTTTGTGTTTACTCTTTGTAAAGCAAAGAGGTCT

GTATTTACACACCTTTACCTAGGGGTATGTTTTCTGCCCTGCTTCCCAGTCCTCATGATTATCTTTAATACCCTAGGCCTGGATTGAGAGGCCTTCCTGT

TCTAAGCCTACAAGTACTACTTGCTATAGCTCAGACTTGTCTACAGTTCTTTGTATGATGCACTTTGGACCCACCCTCTCCTCATGTCACTACTTTGCAC

ACTTCCTCCATGCTCTCACTTTGAAGGAAGCCTGGATGAGGCTAGTGACTCTGTGGGTGTCCTGAACAGTGAAGTTCACTGTCTCCATGTGATTGTTACA

AGCGTTTGTGCAGTTCTACTACAATGATATCTGTATGTCACTGTAATGTTGGCCTTCGTGGGGAACCACACTTGGTGGAGCCCGATTCCCTTGTCTCAGA

CCATGGTTAGTTACATAATTTTATGGACTATAGAGATGGCGTCCCACTGATGTGAGAAACATCACAACAGCGAGGAAAGCACTGTGAGTATATCAGAATG

AAAACATCCCTGCTTCCCAGTCCCCGTGCCCGGCTACTATCCACACTTGACATGCGGAGCAATCCTGCATGTTGGTCCCCATCTCCCCCACTAGAAACCC

ACTTCCAGAGTCATGTTTGCATCACAGTCAAAAGAGAAGTCTGTGCACCTCAAGTGAGGTCCCAGGAGCTTTCCTCGCCCTCCAAACCAAGCATTGAGGG

TAACCCTCAGAACCCATTCTCCTATCTCCTAAAGTGTCGGGGAAAGTTACTGGCCTCTCTCAACAGGGCTCACTCTGAGCTCCACATCCGCCTCCTTCAA

GCAAAGACTTAAAAAGACTGCCCTTGACTCCTTGACACTATATCAAGTGCTGTGTAAGAGAGACTGGTCCGTGGGACCAGCCACACACATTACCTCTTCC

ACTTGAAATGACTCTAAGGTTTTCATTTTATTCAAGCTTTGTGGGACAGACAAACTTTTTAAAAATTACTTTGTTGACTGACAAACCAGCTGCCAGCTTC

TGGCTGCAAAACTGCCTGGTGAAATTGACTTGCTTGGTTTCATTCACCAAACCAACCCAAGTCGTGTCATTCTTGCCTATTAACATCTGATGTAAGGCGC

TCATATAGGCTGTGTGTACAATCTTGGGCACTGATTCCATCAGTAGTATCTTGTACCATCCAAGGAGAGGGCCAGGAAAACATCCACCATCAAATGGTTT

TCCAGCTCCCTCATCTCTTCAAAATTGAGTTCTTGGGAGAACAAAAGGTATGTATCCTGCAGTAGTTAAGCCCTTAAATAATTGGGAGTTGGGAAATCGG

AATCAAAGTATTGGTGCCAGCTCACTGAAGATCTGATTGGGTCAACAGTTGATTAGTGGAAGACGGAGAGCAGAAGAATTTTGTCATATCTATTAGGCCA

GAAAGTAATCACTGAAGAAGCAGATGGTAGGAGCTGGAGCAAGGTGGTCCACAGGGGAATGCCTCTCCTGTGCCCATTTTATAATACCTCGCCAAGCTTG

GGTCTTTAGATGAGCAAGATTATGGTTAGTGGGGGCTCTGTGGAGCATGCACGTAGTGCCCTTCCTTCATCAGGCCAAAGCACCAAGTTGCTTCACTGCC

TCGGCCTTTTGTCCAGCTCAGCCTGGGATGTCTATAGGGTTGAGGGTTTTAGACAATCTCTAGGAAAGGGATACAAAACAGATCCGATGGAAGAAACCTA

CTTCCCTATCCTGCCTATCCTGCCCCTCAACCTCTTCATTCCTAATTCCTCCAAGGTACTATTTCATAGTTGCTCTGAATTAAGGATTTCAGGTTTAACT

GGTAGTGAAAGACTGCACCTAGCATCTTCGGGAAGAAATGATTCCAGTCTATTGGCTGATACTACATTAGTTTCCCTTTCTGATTCTTAATCTGTAGTTC

TTTGTTATATTTCACAAAAAAAAAAAATGTCTCGGTCACTACGCAAAGCTGCTAGTGGGGTTCTGTATTTTGTGTCATCTTTTTTATTATAATTTATTGC

AATTTTATGAATAAATATATGTTGTGTG
Translation
MEPRLPIGAQPLA MVAGLEMKGPLREPCVLTLARRNGQYE ELIIQLHGKEQHVQDIIPINSHFRCVQE EAEETLLIDIASNS SGCKIRVQGDWTRE

RHFEIPDEERCLKFLSEVLEAQEA AQSQLLVPEQKDSSSWYQKLDTMDKPAYSG GLLGFEDNFSSLDLDKKMNTQNPRSGSHREPPPPPSSSTRM ML

SREKEASNKEQPKVTNTMRKLFVPNTQTGQREGLIKHILTKREKEYVNIQSFR RFFVGTWNVNGQSPDSSLEPWLDCDPNPPDIYCIG GFQELDLSTE

AFFYFESVKEQEWSLAVERGLPSKAKYRK VQLVRLVGMMLLIFARKDQCQYIRDVATETTGTGIMGKM GNKGGVAVRFVFHNTTFCIVNSHLAAHVEE

FERRNQDYKDICARMTFSVPNQTVPQVNIMKHD DVVIWLGDLNYRLCMPDASEVKSLINKNELHKLLKFDQ - UNI2210 - LNIQRTQKKAFADFN

EGEINFVPTYKYDSKTDRWDSS SGKCRVPAWCDRILWRGINVNQLHYRSHMELKTSDHKPVSALFHIG VKVVDERRYRKVFEDIVRIMDRMENDFLPS

LELSRRE FFFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPN NETLDISLDVYVSKDSVTILNSGEDKIEDILVLHL

DRGKDYFLTIGGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDL EEDSYLEK EKSLLQMVPLDEGTSERPLQVPKEIWLLVDHLFKYACHQ EDLFQT

PGMQEELQQIIDCLDTSIPETIP PGNNHSVAEALLIFLEALPEPVICYELYQRCLDSAHDPRICKQ - UNI18599 - VISQLPRCHRNVFRYLMAF

LRELLKFSDYNNINTNMIA ATLFSSLLLRPPPNLMTRQTPNDRQHAIQFLLVFLLGNEED

For any suggestions or comments, please send an email to unitrap@crg.es