Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001228 (Uhrf1)
Chromosomal location
Chr 17: 56442823 - 56462909 (+)
Description
ubiquitin-like, containing PHD and RING finger domains, 1 Gene [Source:MGI (curated);Acc:Uhrf1-002]
RefSeq_dna
NM_010931 
RefSeq_peptide
NP_001104549.1 NP_001104550.1 NP_035061.3 NP_001104548.1 
UniGene
Mm.291311 Mm.42196 
MGI
MGI:1338889 
Uniprot/SWISSPROT
Q8VDF2 
Uniprot/SPTREMBL
Q3U9D7 Q3UI74 Q3U9P2 Q3UIE6 Q3ULF2 Q3ULQ0 
Human Ortholog
ENSG00000034063 (UHRF1)
Omim not available
UniTrap UNI37569
Vector Insertion
Chr 17: 56442839 - 56442985
Public Clones (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15335
Vector Insertion
Chr 17: 56442985 - 56443735
Public Clones PST3681-NR (escells) IST13902C9 (tigm) IST14527F4 (tigm) IST10199D5 (tigm)
IST10841C1 (tigm) IST14227D10 (tigm) IST13900C9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31362
Vector Insertion
Chr 17: 56443817 - 56444508
Public Clones IST14268C7 (tigm) IST10897A7 (tigm) IST10313A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7686
Vector Insertion
Chr 17: 56444508 - 56444674
Public Clones XK163 (baygenomics) XL795 (baygenomics) XK164 (baygenomics) RRS131 (baygenomics)
XL796 (baygenomics) RRS239 (baygenomics)
Private Clones OST286487 (lexicon) OST240060 (lexicon) OST215655 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38082
Vector Insertion
Chr 17: 56444674 - 56448759
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6226
Vector Insertion
Chr 17: 56449003 - 56450098
Public Clones CSG386 (baygenomics) RRS105 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9084
Vector Insertion
Chr 17: 56459966 - 56461443
Public Clones XK123 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113035
Sequence
GGTCTTTAAAGCGCCTTTCCGGGAGGCCAGGGTCTGTGTCCCGAGGGGAAGTTAGGGCAGCCAGCTGTGGGTGGGGTTCAG - UNI7686 - - UNI3

1362 - TACATCGGCATCATGTGGATCCAGGTTCGAACTATGGATGGGAAGGAGACCCACACCGTGAACTCTCTGTCCAGGTTGACCAAGGTGCAGGAG

CTGAGGAAAAAGATTGAGGAAGTGTTTCACGTGGAACCCCAACTACAGAGACTCTTTTATAGGGGCAAACAG - UNI7686 - ATGGAGGATGGCCAC

ACACTCTTCGATTATGATGTGCGCCTCAATGACACAATCCAGCTGCTCGTGCGCCAGAGTCTGGCACTGCCTCTCAGTACAAAAGAACGGGACTCGGAGC

TCTCAGACTCTGACTCTGGCTATGGTGTGGGTCACAGTGAATCAGACAAGTCGTCCACGCATGGTGAAGGGGCAGCTGAAGCGGATGACAAGACTGTGTG

GGAGGACACGGACCTGGGGCTGTACAAG - UNI6226 - GTCAATGAGTATGTGGACGTGCGTGACAATATCTTCGGTGCATGGTTTGAGGCCCAGGT

GGTCCAGGTACAGAAGAGAGCCCTATCTGAGGACGAGCCCTGTAGCTCCAGTGCCGTTAAGACCTCGGAGGATGACATCATGTACCATGTCAAGTATGAT

GA CTATCCAGAGCATGGAGTGGACATTGTCAAAGCCAAGAATGTCCGTGCTCGTGCTCGCACTGTGATACCATGGGAGAACCTGGAGGTGGGTCAGGTG

GTCATGGCCAACTATAACGTGGACTACCCCAGGAAACGCGGCTTCTGGTATGATGTTGAGATCTGTAGGAAGCGCCAAACCAGGACGGCACGTGAGCTAT

ACGGCAACATCAGGCTCTT GAATGACTCTCAGCTCAACAACTGTCGGATCATGTTTGTGGATGAAGTCTTGATGATTGAGCTCCCTAAAGAGAGGAGGC

CTTTGATCGCTAGCCCCTCGCAAC GGAAGAGCGGCCCATCCTGCCGGTTCTGCAAGGATGATGAAAACAAACCATGTCGAAAGTGTGCCTGCCATGTGT

GTGGTGGGCGCGAGGCTCCTGAGAAACAGCTGTTGTGTGATGAGTGTGACATGGCCTTCCACCTGTACTGCCTGAAGCCACCGCTCACCTCTGTCCCCCC

TGAGCCGGAGTG GTACTGCCCCAGCTGCCGCACTGACTCAAGTGAGGTGGTACAAGCAGGGGAGAAGCTGAAGGAGAGCAAGAAGAAGGCAAAGATGGC

ATCAGCCACTTCCTCCTCCCGGCGGGACTGGGGCAAG GGCATGGCATGTGTGGGCCGCACCACAGAGTGTACCATTGTGCCCGCCAACCACTTCGGGCC

CATCCCTGGTGTCCCTGTGGGCACCATGTGGCGCTTCAGAGTCCAG GTCAGTGAGTCCGGTGTGCATCGGCCTCATGTGGCAGGCATCCATGGCCGGAG

CAACGACGGTGCCTACTCATTGGTCCTGGCTGGTGGCTATGAGGATGATGTG GACAATGGCAATTACTTCACATACACAGGGAGTGGTGGCCGAGACCT

CTCTGGCAACAAGCGTACAGCAGGCCAGTCCTCTGACCAGAAGCTCACTAATAACAATAG GGCTCTGGCACTCAATTGCCACTCCCCAATCAATGAGAA

AGGTGCGGAGGCTGAAGACTGGCGCCAAGGGAAGCCAGTGCGTGTGGTCCGGAACATGAAGGGCGGGAAACACAGCAAGTACGCTCCTGCAGAGGGCAAC

CGCTATGATGGCATCTACAAG GTGGTGAAGTACTGGCCAGAGAGAGGGAAATCTGGCTTCCTCGTGTGGCGTTATCTCCTTCGACGAGATGACACAGAG

CCTGAGCCCTGGACCCGGGAGGGCAAGGACCGCACTCGACAGCTGGGGCTCACTATGCAG TACCCTGAAGGCTACTTGGAGGCCTTGGCTAACAAGGAG

AAGAGCAGGAAGCGCCCGGCCAAGGCCTTGGAGCAGGGACCCTCATCTTCCAAGACAGGCAAAAGCAAGCAGAAGTCCACAG GGCCAACCCTCTCCAGC

CCCCGTGCCTCTAAGAAGAGCAAGCTGGAGCCGTACACACTCTCAGAGCAGCAGGCTAACCTCATCAAAGAGGACAAGGGCAACGCCAAGCTGTGGGATG

ATGTGCTAACTTCACTTCAGGATGGGCCG - UNI9084 - TACCAGATCTTCCTGAGCAAGGTGAAAGAGGCTTTCCAGTGCATCTGCTGCCAGGAGC

TGGTGTTCCGGCCAGTCACCACCGTGTGTCAGCACAACGTCTGTAAG GACTGTCTGGACAGGTCCTTCCGGGCCCAGGTGTTCAGCTGCCCAGCCTGTC

GCTTTGAGCTGGACCACAGCTCCCCAACCCGGGTGAACCAGCCCTTGCAGACCATTCTCAACCAGCTCTTCCCTGGCTATGGCAGCGGCCGGTGATGCTG

AGACCCAGGCAGAGGGCTCATGGTTCCAACTTCATAGTGTGTTTAGCTTGAAGGTGTTGTCCTTCACGTCTGCCTGTGGCAACTCTTCTGATCTGGTCAC

CAGTTAACCAGGCATCTATAGGAATCCCATGTTCTGGCTACCAGTTGGACTTCTGTTTTTCATCCCTCCACCCCCTTTCTATAACAAAGCCTGCGATTTA

TTGTCCAAGAGAAGGAAAAAAATGTTTTTGTTTTTGTTTTTTTTTTTTTGAGATGGGTTTAGAAACCGTTGAGTTTCATACCAGGCCTCATGTCATGCTG

GTAGGAGTTCTCCCCACACCAGCTGCCTAGAAACCATCTGCACCCATCTTTGAAAAGCCCAGACATGTCTTCCTGGCAGCTATCTGTGTGCTTCATTCCA

GGGGTGGCCCCTGCAGCTGCCCCTCAGACCTTCATAGATGCCCTGGCCCGCGCCATTCACTGACATGATTGCAGAGGGGAGTTGGCTGTGGCCTCAGGCC

AGGGGACCAGCTGGGCTGAAGCTGCATGTGCCTTGGGCTGGCCACTTCTTCACTCCCCTCACCACTGAGCATTGGATGTCTACCTTGAAAGCCTGGTTTT

CAGAGAGTGCACTGACTGGGTGTCATGGAAGGCAGAGATGTGTTATCAGTTCCATCTCATTTTTAACTCAGCAACAGAATTCTGAGGGTTTCTGTATTAT

GGGTTTTTTTATTTTTATTTTTTAAAGCGAGATAAATGGGTTTCCTCGATGAATTTCTTTTGTAGTTACAGCCTGTACTGAGGAAGATGTTTTCCTTGGT

AGGTTTTGTTTCTTTTGTAACTTTACCAAAGTGTGCAGGTGTGTCTCATGGAAACTAAACCATTTACTACAGGCAGACTGGACAGCACAGTTCTAAGGGT

TGTGTTTTGTTTTGTGTGGGGTATTTTTTCCTTGTTAGATTGTTAACATATTGCAATAAAATAAAATTCTGGCCGGGCA
Translation
 - UNI7686 - - UNI31362 - MWIQVRTMDGKETHTVNSLSRLTKVQELRKKIEEVFHVEPQLQRLFYRGKQ - UNI7686 - MEDGHTLFDY

DVRLNDTIQLLVRQSLALPLSTKERDSELSDSDSGYGVGHSESDKSSTHGEGAAEADDKTVWEDTDLGLYK - UNI6226 - VNEYVDVRDNIFGAWF

EAQVVQVQKRALSEDEPCSSSAVKTSEDDIMYHVKYDD DYPEHGVDIVKAKNVRARARTVIPWENLEVGQVVMANYNVDYPRKRGFWYDVEICRKRQTR

TARELYGNIRLL LNDSQLNNCRIMFVDEVLMIELPKERRPLIASPSQR RKSGPSCRFCKDDENKPCRKCACHVCGGREAPEKQLLCDECDMAFHLYCL

KPPLTSVPPEPEW WYCPSCRTDSSEVVQAGEKLKESKKKAKMASATSSSRRDWGK GMACVGRTTECTIVPANHFGPIPGVPVGTMWRFRVQ VSESGV

HRPHVAGIHGRSNDGAYSLVLAGGYEDDV DNGNYFTYTGSGGRDLSGNKRTAGQSSDQKLTNNNR RALALNCHSPINEKGAEAEDWRQGKPVRVVRNM

KGGKHSKYAPAEGNRYDGIYK VVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKDRTRQLGLTMQ YPEGYLEALANKEKSRKRPAKALEQGPSSSK

TGKSKQKSTG GPTLSSPRASKKSKLEPYTLSEQQANLIKEDKGNAKLWDDVLTSLQDGP - UNI9084 - YQIFLSKVKEAFQCICCQELVFRPVTT

VCQHNVCK DCLDRSFRAQVFSCPACRFELDHSSPTRVNQPLQTILNQLFPGYGSGR
Transcript ENSMUST00000113038
Sequence
GGGAAAAAAAGTCCTAGCAGCTGGAAGGAACCCGCGCTCTAGTGCTCACTTGGGTCTTCAGCCACTCACGCGGCTCCCTTCTGGGTCACCCAGCCGCAGA

GCCCTAGCCTAGAACCAGGCGTTCCAAGGGAGAGGAGAGTGCGGATCGCCGCCGTGAGAGAG - UNI7686 - - UNI15335 - - UNI31362 -

 TACATCGGCATCATGTGGATCCAGGTTCGAACTATGGATGGGAAGGAGACCCACACCGTGAACTCTCTGTCCAGGTTGACCAAGGTGCAGGAGCTGAGG

AAAAAGATTGAGGAAGTGTTTCACGTGGAACCCCAACTACAGAGACTCTTTTATAGGGGCAAACAG - UNI7686 - ATGGAGGATGGCCACACACTC

TTCGATTATGATGTGCGCCTCAATGACACAATCCAGCTGCTCGTGCGCCAGAGTCTGGCACTGCCTCTCAGTACAAAAGAACGGGACTCGGAGCTCTCAG

ACTCTGACTCTGGCTATGGTGTGGGTCACAGTGAATCAGACAAGTCGTCCACGCATGGTGAAGGGGCAGCTGAAGCGGATGACAAGACTGTGTGGGAGGA

CACGGACCTGGGGCTGTACAAG - UNI6226 - GTCAATGAGTATGTGGACGTGCGTGACAATATCTTCGGTGCATGGTTTGAGGCCCAGGTGGTCCA

GGTACAGAAGAGAGCCCTATCTGAGGACGAGCCCTGTAGCTCCAGTGCCGTTAAGACCTCGGAGGATGACATCATGTACCATGTCAAGTATGATGA CTA

TCCAGAGCATGGAGTGGACATTGTCAAAGCCAAGAATGTCCGTGCTCGTGCTCGCACTGTGATACCATGGGAGAACCTGGAGGTGGGTCAGGTGGTCATG

GCCAACTATAACGTGGACTACCCCAGGAAACGCGGCTTCTGGTATGATGTTGAGATCTGTAGGAAGCGCCAAACCAGGACGGCACGTGAGCTATACGGCA

ACATCAGGCTCTT GAATGACTCTCAGCTCAACAACTGTCGGATCATGTTTGTGGATGAAGTCTTGATGATTGAGCTCCCTAAAGAGAGGAGGCCTTTGA

TCGCTAGCCCCTCGCAAC GGAAGAGCGGCCCATCCTGCCGGTTCTGCAAGGATGATGAAAACAAACCATGTCGAAAGTGTGCCTGCCATGTGTGTGGTG

GGCGCGAGGCTCCTGAGAAACAGCTGTTGTGTGATGAGTGTGACATGGCCTTCCACCTGTACTGCCTGAAGCCACCGCTCACCTCTGTCCCCCCTGAGCC

GGAGTG GTACTGCCCCAGCTGCCGCACTGACTCAAGTGAGGTGGTACAAGCAGGGGAGAAGCTGAAGGAGAGCAAGAAGAAGGCAAAGATGGCATCAGC

CACTTCCTCCTCCCGGCGGGACTGGGGCAAG GGCATGGCATGTGTGGGCCGCACCACAGAGTGTACCATTGTGCCCGCCAACCACTTCGGGCCCATCCC

TGGTGTCCCTGTGGGCACCATGTGGCGCTTCAGAGTCCAG GTCAGTGAGTCCGGTGTGCATCGGCCTCATGTGGCAGGCATCCATGGCCGGAGCAACGA

CGGTGCCTACTCATTGGTCCTGGCTGGTGGCTATGAGGATGATGTG GACAATGGCAATTACTTCACATACACAGGGAGTGGTGGCCGAGACCTCTCTGG

CAACAAGCGTACAGCAGGCCAGTCCTCTGACCAGAAGCTCACTAATAACAATAG GGCTCTGGCACTCAATTGCCACTCCCCAATCAATGAGAAAGGTGC

GGAGGCTGAAGACTGGCGCCAAGGGAAGCCAGTGCGTGTGGTCCGGAACATGAAGGGCGGGAAACACAGCAAGTACGCTCCTGCAGAGGGCAACCGCTAT

GATGGCATCTACAAG GTGGTGAAGTACTGGCCAGAGAGAGGGAAATCTGGCTTCCTCGTGTGGCGTTATCTCCTTCGACGAGATGACACAGAGCCTGAG

CCCTGGACCCGGGAGGGCAAGGACCGCACTCGACAGCTGGGGCTCACTATGCAG TACCCTGAAGGCTACTTGGAGGCCTTGGCTAACAAGGAGAAGAGC

AGGAAGCGCCCGGCCAAGGCCTTGGAGCAGGGACCCTCATCTTCCAAGACAGGCAAAAGCAAGCAGAAGTCCACAG GGCCAACCCTCTCCAGCCCCCGT

GCCTCTAAGAAGAGCAAGCTGGAGCCGTACACACTCTCAGAGCAGCAGGCTAACCTCATCAAAGAGGACAAGGGCAACGCCAAGCTGTGGGATGATGTGC

TAACTTCACTTCAGGATGGGCCG - UNI9084 - TACCAGATCTTCCTGAGCAAGGTGAAAGAGGCTTTCCAGTGCATCTGCTGCCAGGAGCTGGTGT

TCCGGCCAGTCACCACCGTGTGTCAGCACAACGTCTGTAAG GACTGTCTGGACAGGTCCTTCCGGGCCCAGGTGTTCAGCTGCCCAGCCTGTCGCTTTG

AGCTGGACCACAGCTCCCCAACCCGGGTGAACCAGCCCTTGCAGACCATTCTCAACCAGCTCTTCCCTGGCTATGGCAGCGGCCGGTGATGCTGAGACCC

AGGCAGAGGGCTCATGGTTCCAACTTCATAGTGTGTTTAGCTTGAAGGTGTTGTCCTTCACGTCTGCCTGTGGCAACTCTTCTGATCTGGTCACCAGTTA

ACCAGGCATCTATAGGAATCCCATGTTCTGGCTACCAGTTGGACTTCTGTTTTTCATCCCTCCACCCCCTTTCTATAACAAAGCCTGCGATTTATTGTCC

AAGAGAAGGAAAAAAATGTTTTTGTTTTTGTTTTTTTTTTTTTGAGATGGGTTTAGAAACCGTTGAGTTTCATACCAGGCCTCATGTCATGCTGGTAGGA

GTTCTCCCCACACCAGCTGCCTAGAAACCATCTGCACCCATCTTTGAAAAGCCCAGACATGTCTTCCTGGCAGCTATCTGTGTGCTTCATTCCAGGGGTG

GCCCCTGCAGCTGCCCCTCAGACCTTCATAGATGCCCTGGCCCGCGCCATTCACTGACATGATTGCAGAGGGGAGTTGGCTGTGGCCTCAGGCCAGGGGA

CCAGCTGGGCTGAAGCTGCATGTGCCTTGGGCTGGCCACTTCTTCACTCCCCTCACCACTGAGCATTGGATGTCTACCTTGAAAGCCTGGTTTTCAGAGA

GTGCACTGACTGGGTGTCATGGAAGGCAGAGATGTGTTATCAGTTCCATCTCATTTTTAACTCAGCAACAGAATTCTGAGGGTTTCTGTATTATGGGTTT

TTTTATTTTTATTTTTTAAAGCGAGATAAATGGGTTTCCTCGATGAATTTCTTTTGTAGTTACAGCCTGTACTGAGGAAGATGTTTTCCTTGGTAGGTTT

TGTTTCTTTTGTAACTTTACCAAAGTGTGCAGGTGTGTCTCATGGAAACTAAACCATTTACTACAGGCAGACTGGACAGCACAGTTCTAAGGGTTGTGTT

TTGTTTTGTGTGGGGTATTTTTTCCTTGTTAGATTGTTAACATATTGCAATAAAATAAAATTCTGGCCGGGCA
Translation
 - UNI7686 - - UNI15335 - - UNI31362 - MWIQVRTMDGKETHTVNSLSRLTKVQELRKKIEEVFHVEPQLQRLFYRGKQ - UNI7686

 - MEDGHTLFDYDVRLNDTIQLLVRQSLALPLSTKERDSELSDSDSGYGVGHSESDKSSTHGEGAAEADDKTVWEDTDLGLYK - UNI6226 - VNE

YVDVRDNIFGAWFEAQVVQVQKRALSEDEPCSSSAVKTSEDDIMYHVKYDD DYPEHGVDIVKAKNVRARARTVIPWENLEVGQVVMANYNVDYPRKRGF

WYDVEICRKRQTRTARELYGNIRLL LNDSQLNNCRIMFVDEVLMIELPKERRPLIASPSQR RKSGPSCRFCKDDENKPCRKCACHVCGGREAPEKQLL

CDECDMAFHLYCLKPPLTSVPPEPEW WYCPSCRTDSSEVVQAGEKLKESKKKAKMASATSSSRRDWGK GMACVGRTTECTIVPANHFGPIPGVPVGTM

WRFRVQ VSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDV DNGNYFTYTGSGGRDLSGNKRTAGQSSDQKLTNNNR RALALNCHSPINEKGAEAED

WRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYK VVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKDRTRQLGLTMQ YPEGYLEALANKEKSRKR

PAKALEQGPSSSKTGKSKQKSTG GPTLSSPRASKKSKLEPYTLSEQQANLIKEDKGNAKLWDDVLTSLQDGP - UNI9084 - YQIFLSKVKEAFQC

ICCQELVFRPVTTVCQHNVCK DCLDRSFRAQVFSCPACRFELDHSSPTRVNQPLQTILNQLFPGYGSGR
Transcript ENSMUST00000113039
Sequence
GTGTCCCGAGGGGAAGTTAGGGCAGCCAGCTGTGGGTGGGGTTCAG - UNI7686 - - UNI31362 - TACATCGGCATCATGTGGATCCAGGTTC

GAACTATGGATGGGAAGGAGACCCACACCGTGAACTCTCTGTCCAGGTTGACCAAGGTGCAGGAGCTGAGGAAAAAGATTGAGGAAGTGTTTCACGTGGA

ACCCCAACTACAGAGACTCTTTTATAGGGGCAAACAG - UNI7686 - ATGGAGGATGGCCACACACTCTTCGATTATGATGTGCGCCTCAATGACAC

AATCCAGCTGCTCGTGCGCCAGAGTCTGGCACTGCCTCTCAGTACAAAAGAACGGGACTCGGAGCTCTCAGACTCTGACTCTGGCTATGGTGTGGGTCAC

AGTGAATCAGACAAGTCGTCCACGCATGGTGAAGGGGCAGCTGAAGCGGATGACAAGACTGTGTGGGAGGACACGGACCTGGGGCTGTACAAG - UNI6

226 - GTCAATGAGTATGTGGACGTGCGTGACAATATCTTCGGTGCATGGTTTGAGGCCCAGGTGGTCCAGGTACAGAAGAGAGCCCTATCTGAGGACG

AGCCCTGTAGCTCCAGTGCCGTTAAGACCTCGGAGGATGACATCATGTACCATGTCAAGTATGATGA CTATCCAGAGCATGGAGTGGACATTGTCAAAG

CCAAGAATGTCCGTGCTCGTGCTCGCACTGTGATACCATGGGAGAACCTGGAGGTGGGTCAGGTGGTCATGGCCAACTATAACGTGGACTACCCCAGGAA

ACGCGGCTTCTGGTATGATGTTGAGATCTGTAGGAAGCGCCAAACCAGGACGGCACGTGAGCTATACGGCAACATCAGGCTCTT GAATGACTCTCAGCT

CAACAACTGTCGGATCATGTTTGTGGATGAAGTCTTGATGATTGAGCTCCCTAAAGAGAGGAGGCCTTTGATCGCTAGCCCCTCGCAAC CCCCTCCTGC

CCTCCGGAACACAGGGAAGAGCGGCCCATCCTGCCGGTTCTGCAAGGATGATGAAAACAAACCATGTCGAAAGTGTGCCTGCCATGTGTGTGGTGGGCGC

GAGGCTCCTGAGAAACAGCTGTTGTGTGATGAGTGTGACATGGCCTTCCACCTGTACTGCCTGAAGCCACCGCTCACCTCTGTCCCCCCTGAGCCGGAGT

G GTACTGCCCCAGCTGCCGCACTGACTCAAGTGAGGTGGTACAAGCAGGGGAGAAGCTGAAGGAGAGCAAGAAGAAGGCAAAGATGGCATCAGCCACTT

CCTCCTCCCGGCGGGACTGGGGCAAG GGCATGGCATGTGTGGGCCGCACCACAGAGTGTACCATTGTGCCCGCCAACCACTTCGGGCCCATCCCTGGTG

TCCCTGTGGGCACCATGTGGCGCTTCAGAGTCCAG GTCAGTGAGTCCGGTGTGCATCGGCCTCATGTGGCAGGCATCCATGGCCGGAGCAACGACGGTG

CCTACTCATTGGTCCTGGCTGGTGGCTATGAGGATGATGTG GACAATGGCAATTACTTCACATACACAGGGAGTGGTGGCCGAGACCTCTCTGGCAACA

AGCGTACAGCAGGCCAGTCCTCTGACCAGAAGCTCACTAATAACAATAG GGCTCTGGCACTCAATTGCCACTCCCCAATCAATGAGAAAGGTGCGGAGG

CTGAAGACTGGCGCCAAGGGAAGCCAGTGCGTGTGGTCCGGAACATGAAGGGCGGGAAACACAGCAAGTACGCTCCTGCAGAGGGCAACCGCTATGATGG

CATCTACAAG GTGGTGAAGTACTGGCCAGAGAGAGGGAAATCTGGCTTCCTCGTGTGGCGTTATCTCCTTCGACGAGATGACACAGAGCCTGAGCCCTG

GACCCGGGAGGGCAAGGACCGCACTCGACAGCTGGGGCTCACTATGCAG TACCCTGAAGGCTACTTGGAGGCCTTGGCTAACAAGGAGAAGAGCAGGAA

GCGCCCGGCCAAGGCCTTGGAGCAGGGACCCTCATCTTCCAAGACAGGCAAAAGCAAGCAGAAGTCCACAG GGCCAACCCTCTCCAGCCCCCGTGCCTC

TAAGAAGAGCAAGCTGGAGCCGTACACACTCTCAGAGCAGCAGGCTAACCTCATCAAAGAGGACAAGGGCAACGCCAAGCTGTGGGATGATGTGCTAACT

TCACTTCAGGATGGGCCG - UNI9084 - TACCAGATCTTCCTGAGCAAGGTGAAAGAGGCTTTCCAGTGCATCTGCTGCCAGGAGCTGGTGTTCCGG

CCAGTCACCACCGTGTGTCAGCACAACGTCTGTAAG GACTGTCTGGACAGGTCCTTCCGGGCCCAGGTGTTCAGCTGCCCAGCCTGTCGCTTTGAGCTG

GACCACAGCTCCCCAACCCGGGTGAACCAGCCCTTGCAGACCATTCTCAACCAGCTCTTCCCTGGCTATGGCAGCGGCCGGTGATGCTGAGACCCAGGCA

GAGGGCTCATGGTTCCAACTTCATAGTGTGTTTAGCTTGAAGGTGTTGTCCTTCACGTCTGCCTGTGGCAACTCTTCTGATCTGGTCACCAGTTAACCAG

GCATCTATAGGAATCCCATGTTCTGGCTACCAGTTGGACTTCTGTTTTTCATCCCTCCACCCCCTTTCTATAACAAAGCCTGCGATTTATTGTCCAAGAG

AAGGAAAAAAATGTTTTTGTTTTTGTTTTTTTTTTTTTGAGATGGGTTTAGAAACCGTTGAGTTTCATACCAGGCCTCATGTCATGCTGGTAGGAGTTCT

CCCCACACCAGCTGCCTAGAAACCATCTGCACCCATCTTTGAAAAGCCCAGACATGTCTTCCTGGCAGCTATCTGTGTGCTTCATTCCAGGGGTGGCCCC

TGCAGCTGCCCCTCAGACCTTCATAGATGCCCTGGCCCGCGCCATTCACTGACATGATTGCAGAGGGGAGTTGGCTGTGGCCTCAGGCCAGGGGACCAGC

TGGGCTGAAGCTGCATGTGCCTTGGGCTGGCCACTTCTTCACTCCCCTCACCACTGAGCATTGGATGTCTACCTTGAAAGCCTGGTTTTCAGAGAGTGCA

CTGACTGGGTGTCATGGAAGGCAGAGATGTGTTATCAGTTCCATCTCATTTTTAACTCAGCAACAGAATTCTGAGGGTTTCTGTATTATGGGTTTTTTTA

TTTTTATTTTTTAAAGCGAGATAAATGGGTTTCCTCGATGAATTTCTTTTGTAGTTACAGCCTGTACTGAGGAAGATGTTTTCCTTGGTAGGTTTTGTTT

CTTTTGTAACTTTACCAAAGTGTGCAGGTGTGTCTCATGGAAACTAAACCATTTACTACAGGCAGACTGGACAGCACAGTTCTAAGGGTTGTGTTTTGTT

TTGTGTGGGGTATTTTTTCCTTGTTAGATTGTTAACATATTGCAATAAAATAAAATTCTGGCCGGGC
Translation
 - UNI7686 - - UNI31362 - MWIQVRTMDGKETHTVNSLSRLTKVQELRKKIEEVFHVEPQLQRLFYRGKQ - UNI7686 - MEDGHTLFDY

DVRLNDTIQLLVRQSLALPLSTKERDSELSDSDSGYGVGHSESDKSSTHGEGAAEADDKTVWEDTDLGLYK - UNI6226 - VNEYVDVRDNIFGAWF

EAQVVQVQKRALSEDEPCSSSAVKTSEDDIMYHVKYDD DYPEHGVDIVKAKNVRARARTVIPWENLEVGQVVMANYNVDYPRKRGFWYDVEICRKRQTR

TARELYGNIRLL LNDSQLNNCRIMFVDEVLMIELPKERRPLIASPSQP PPPALRNTGKSGPSCRFCKDDENKPCRKCACHVCGGREAPEKQLLCDECD

MAFHLYCLKPPLTSVPPEPEW WYCPSCRTDSSEVVQAGEKLKESKKKAKMASATSSSRRDWGK GMACVGRTTECTIVPANHFGPIPGVPVGTMWRFRV

Q VSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDV DNGNYFTYTGSGGRDLSGNKRTAGQSSDQKLTNNNR RALALNCHSPINEKGAEAEDWRQGK

PVRVVRNMKGGKHSKYAPAEGNRYDGIYK VVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKDRTRQLGLTMQ YPEGYLEALANKEKSRKRPAKAL

EQGPSSSKTGKSKQKSTG GPTLSSPRASKKSKLEPYTLSEQQANLIKEDKGNAKLWDDVLTSLQDGP - UNI9084 - YQIFLSKVKEAFQCICCQE

LVFRPVTTVCQHNVCK DCLDRSFRAQVFSCPACRFELDHSSPTRVNQPLQTILNQLFPGYGSGR
Transcript ENSMUST00000001258
Sequence
CAGCTGGAAGGAACCCGCGCTCTAGTGCTCACTTGGGTCTTCAGCCACTCACGCGGCTCCCTTCTGGGTCACCCAGCCGCAGAGCCCTAGCCTAGAACCA

GGCGTTCCAAGGGAGAGGAGAGTGCGGATCGCCGCCGTGAGAGAG - UNI7686 - - UNI15335 - - UNI31362 - TACATCGGCATCATGT

GGATCCAGGTTCGAACTATGGATGGGAAGGAGACCCACACCGTGAACTCTCTGTCCAGGTTGACCAAGGTGCAGGAGCTGAGGAAAAAGATTGAGGAAGT

GTTTCACGTGGAACCCCAACTACAGAGACTCTTTTATAGGGGCAAACAG - UNI7686 - ATGGAGGATGGCCACACACTCTTCGATTATGATGTGCG

CCTCAATGACACAATCCAGCTGCTCGTGCGCCAGAGTCTGGCACTGCCTCTCAGTACAAAAGAACGGGACTCGGAGCTCTCAGACTCTGACTCTGGCTAT

GGTGTGGGTCACAGTGAATCAGACAAGTCGTCCACGCATGGTGAAGGGGCAGCTGAAGCGGATGACAAGACTGTGTGGGAGGACACGGACCTGGGGCTGT

ACAAG - UNI6226 - GTCAATGAGTATGTGGACGTGCGTGACAATATCTTCGGTGCATGGTTTGAGGCCCAGGTGGTCCAGGTACAGAAGAGAGCCC

TATCTGAGGACGAGCCCTGTAGCTCCAGTGCCGTTAAGACCTCGGAGGATGACATCATGTACCATGTCAAGTATGATGA CTATCCAGAGCATGGAGTGG

ACATTGTCAAAGCCAAGAATGTCCGTGCTCGTGCTCGCACTGTGATACCATGGGAGAACCTGGAGGTGGGTCAGGTGGTCATGGCCAACTATAACGTGGA

CTACCCCAGGAAACGCGGCTTCTGGTATGATGTTGAGATCTGTAGGAAGCGCCAAACCAGGACGGCACGTGAGCTATACGGCAACATCAGGCTCTT GAA

TGACTCTCAGCTCAACAACTGTCGGATCATGTTTGTGGATGAAGTCTTGATGATTGAGCTCCCTAAAGAGAGGAGGCCTTTGATCGCTAGCCCCTCGCAA

C CCCCTCCTGCCCTCCGGAACACAGGGAAGAGCGGCCCATCCTGCCGGTTCTGCAAGGATGATGAAAACAAACCATGTCGAAAGTGTGCCTGCCATGTG

TGTGGTGGGCGCGAGGCTCCTGAGAAACAGCTGTTGTGTGATGAGTGTGACATGGCCTTCCACCTGTACTGCCTGAAGCCACCGCTCACCTCTGTCCCCC

CTGAGCCGGAGTG GTACTGCCCCAGCTGCCGCACTGACTCAAGTGAGGTGGTACAAGCAGGGGAGAAGCTGAAGGAGAGCAAGAAGAAGGCAAAGATGG

CATCAGCCACTTCCTCCTCCCGGCGGGACTGGGGCAAG GGCATGGCATGTGTGGGCCGCACCACAGAGTGTACCATTGTGCCCGCCAACCACTTCGGGC

CCATCCCTGGTGTCCCTGTGGGCACCATGTGGCGCTTCAGAGTCCAG GTCAGTGAGTCCGGTGTGCATCGGCCTCATGTGGCAGGCATCCATGGCCGGA

GCAACGACGGTGCCTACTCATTGGTCCTGGCTGGTGGCTATGAGGATGATGTG GACAATGGCAATTACTTCACATACACAGGGAGTGGTGGCCGAGACC

TCTCTGGCAACAAGCGTACAGCAGGCCAGTCCTCTGACCAGAAGCTCACTAATAACAATAG GGCTCTGGCACTCAATTGCCACTCCCCAATCAATGAGA

AAGGTGCGGAGGCTGAAGACTGGCGCCAAGGGAAGCCAGTGCGTGTGGTCCGGAACATGAAGGGCGGGAAACACAGCAAGTACGCTCCTGCAGAGGGCAA

CCGCTATGATGGCATCTACAAG GTGGTGAAGTACTGGCCAGAGAGAGGGAAATCTGGCTTCCTCGTGTGGCGTTATCTCCTTCGACGAGATGACACAGA

GCCTGAGCCCTGGACCCGGGAGGGCAAGGACCGCACTCGACAGCTGGGGCTCACTATGCAG TACCCTGAAGGCTACTTGGAGGCCTTGGCTAACAAGGA

GAAGAGCAGGAAGCGCCCGGCCAAGGCCTTGGAGCAGGGACCCTCATCTTCCAAGACAGGCAAAAGCAAGCAGAAGTCCACAG GGCCAACCCTCTCCAG

CCCCCGTGCCTCTAAGAAGAGCAAGCTGGAGCCGTACACACTCTCAGAGCAGCAGGCTAACCTCATCAAAGAGGACAAGGGCAACGCCAAGCTGTGGGAT

GATGTGCTAACTTCACTTCAGGATGGGCCG - UNI9084 - TACCAGATCTTCCTGAGCAAGGTGAAAGAGGCTTTCCAGTGCATCTGCTGCCAGGAG

CTGGTGTTCCGGCCAGTCACCACCGTGTGTCAGCACAACGTCTGTAAG GACTGTCTGGACAGGTCCTTCCGGGCCCAGGTGTTCAGCTGCCCAGCCTGT

CGCTTTGAGCTGGACCACAGCTCCCCAACCCGGGTGAACCAGCCCTTGCAGACCATTCTCAACCAGCTCTTCCCTGGCTATGGCAGCGGCCGGTGATGCT

GAGACCCAGGCAGAGGGCTCATGGTTCCAACTTCATAGTGTGTTTAGCTTGAAGGTGTTGTCCTTCACGTCTGCCTGTGGCAACTCTTCTGATCTGGTCA

CCAGTTAACCAGGCATCTATAGGAATCCCATGTTCTGGCTACCAGTTGGACTTCTGTTTTTCATCCCTCCACCCCCTTTCTATAACAAAGCCTGCGATTT

ATTGTCCAAGAGAAGGAAAAAAATGTTTTTGTTTTTGTTTTTTTTTTTTTGAGATGGGTTTAGAAACCGTTGAGTTTCATACCAGGCCTCATGTCATGCT

GGTAGGAGTTCTCCCCACACCAGCTGCCTAGAAACCATCTGCACCCATCTTTGAAAAGCCCAGACATGTCTTCCTGGCAGCTATCTGTGTGCTTCATTCC

AGGGGTGGCCCCTGCAGCTGCCCCTCAGACCTTCATAGATGCCCTGGCCCGCGCCATTCACTGACATGATTGCAGAGGGGAGTTGGCTGTGGCCTCAGGC

CAGGGGACCAGCTGGGCTGAAGCTGCATGTGCCTTGGGCTGGCCACTTCTTCACTCCCCTCACCACTGAGCATTGGATGTCTACCTTGAAAGCCTGGTTT

TCAGAGAGTGCACTGACTGGGTGTCATGGAAGGCAGAGATGTGTTATCAGTTCCATCTCATTTTTAACTCAGCAACAGAATTCTGAGGGTTTCTGTATTA

TGGGTTTTTTTATTTTTATTTTTTAAAGCGAGATAAATGGGTTTCCTCGATGAATTTCTTTTGTAGTTACAGCCTGTACTGAGGAAGATGTTTTCCTTGG

TAGGTTTTGTTTCTTTTGTAACTTTACCAAAGTGTGCAGGTGTGTCTCATGGAAACTAAACCATTTACTACAGGCAGACTGGACAGCACAGTTCTAAGGG

TTGTGTTTTGTTTTGTGTGGGGTATTTTTTCCTTGTTAGATTGTTAACATATTGCAATAAAATAAAATTCTGGCCGGGC
Translation
 - UNI7686 - - UNI15335 - - UNI31362 - MWIQVRTMDGKETHTVNSLSRLTKVQELRKKIEEVFHVEPQLQRLFYRGKQ - UNI7686

 - MEDGHTLFDYDVRLNDTIQLLVRQSLALPLSTKERDSELSDSDSGYGVGHSESDKSSTHGEGAAEADDKTVWEDTDLGLYK - UNI6226 - VNE

YVDVRDNIFGAWFEAQVVQVQKRALSEDEPCSSSAVKTSEDDIMYHVKYDD DYPEHGVDIVKAKNVRARARTVIPWENLEVGQVVMANYNVDYPRKRGF

WYDVEICRKRQTRTARELYGNIRLL LNDSQLNNCRIMFVDEVLMIELPKERRPLIASPSQP PPPALRNTGKSGPSCRFCKDDENKPCRKCACHVCGGR

EAPEKQLLCDECDMAFHLYCLKPPLTSVPPEPEW WYCPSCRTDSSEVVQAGEKLKESKKKAKMASATSSSRRDWGK GMACVGRTTECTIVPANHFGPI

PGVPVGTMWRFRVQ VSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDV DNGNYFTYTGSGGRDLSGNKRTAGQSSDQKLTNNNR RALALNCHSPIN

EKGAEAEDWRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYK VVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKDRTRQLGLTMQ YPEGYLEALA

NKEKSRKRPAKALEQGPSSSKTGKSKQKSTG GPTLSSPRASKKSKLEPYTLSEQQANLIKEDKGNAKLWDDVLTSLQDGP - UNI9084 - YQIFLS

KVKEAFQCICCQELVFRPVTTVCQHNVCK DCLDRSFRAQVFSCPACRFELDHSSPTRVNQPLQTILNQLFPGYGSGR

For any suggestions or comments, please send an email to unitrap@crg.es