Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001281 (Itgb7)
Chromosomal location
Chr 15: 102046429 - 102062339 (-)
Description
integrin beta 7 Gene [Source:MGI (curated);Acc:Itgb7-001]
RefSeq_peptide
NP_038594.2 
UniGene
Mm.58 
MGI
MGI:96616 
Uniprot/SWISSPROT
P26011 
Human Ortholog
ENSG00000139626 (ITGB7)
Omim not available
UniTrap UNI11884
Vector Insertion
Chr 15: 102058033 - 102062281
Public Clones M042E06 (ggtc) D113A12 (ggtc) (egtc) IST10239B5 (tigm) IST11338E6 (tigm)
IST10918B1 (tigm) IST14904B4 (tigm) IST13841A7 (tigm) IST14725E1 (tigm)
IST13199F8 (tigm) IST10282D6 (tigm)
Private Clones OST419170 (lexicon) OST335962 (lexicon) OST209897 (lexicon) OST207965 (lexicon)
OST182400 (lexicon) OST52047 (lexicon) OST33999 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31995
Vector Insertion
Chr 15: 102054988 - 102058033
Public Clones IST14659H7 (tigm) IST14393F5 (tigm) IST13334C11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24701
Vector Insertion
Chr 15: 102049122 - 102049604
Public Clones not available
Private Clones OST209634 (lexicon)
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10614
Vector Insertion
Chr 15: 102048429 - 102048927
Public Clones P069H03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37326
Vector Insertion
Chr 15: 102046699 - 102046902
Public Clones CMHD-GT_449B3-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000001327
Sequence
GTACACAAGGGCTGCCACTGCCACCGGCGGAGGAAGGGCTGCTCCTCCTCAAGCACCT - UNI11884 - - UNI31995 - GCCATGGTGGATTCA

TCAACTGTTCTCATTTTTCTGCTGGTTCTGGGCGGAGGTCAGAGTGAGTTAGATACCAAGATTACATCCTCTGGGGAGGCCGCAGAATGGGAGGATCCTG

ACCTGTCTCTGCAGGGATCCTGCCAGCCAGTTCCTTCCTGCCAGAAGTGTATTCTCTCACATCCCAGCTGTGCATGGTGCAAACAACTG - UNI31995

 - AACTTCACTGCCTCGGGAGAGGCAGAGGCGAGGCGCTGCGCGCGGCGAGAGGAGCTACTGGCTCGCGGGTGCCCCGCGCAGGAGCTAGAGGAGCCGA

GAGGCCGCCAGGAGGTGCTGCAGGACAAGCCGCTCAGCCAGGGAGATCGCGGCGAGGGGGCCACCCAGCTGGCCCCGCAGCGGATCCGCGTCACGCTGCG

ACCAG - UNI31995 - GGGAGCCCCAGAAATTCCGGGTCCGCTTCCTCCGAGCTGCGGGGTACCCCGTGGACCTATATTACCTTATGGACCTGAGCT

ACTCAATGAAGGACGACTTGGAACGTGTGCGCCAGCTAGGGCATGCCCTGCTGGTCAGGCTGCAGGAGGTCACACATTCTGTGCGCATAG GTTTTGGCT

CCTTCGTGGACAAAACGGTGCTGCCCTTTGTAAGCACCGTGCCCTCCAAGCTTCACCACCCATGCCCCAGCCGACTGGAGCGTTGTCAGCCACCCTTCAG

CTTTCACCACGTGCTGTCCCTCACCGGGGACGCTCAAGCCTTCGAGAGAGAGGTGGGACGCCAGAATGTCTCTGGCAACCTGGACTCACCCGAAGGCGGC

TTTGATGCCATTTTGCAGGCTGCCCTCTGCCAG GAACAGATTGGCTGGAGAAATGTCTCCCGTCTTCTAGTGTTCACTTCAGACGATACATTCCACACA

GCTGGGGATGGGAAACTGGGTGGCATTTTCATGCCCAGCGACGGGCGGTGCCATCTGGACAGCAATGGTGTCTACACGAACAGCGCAGAGTTT GACTAT

CCCTCTGTGGGTCAAGTAGCCCAGGCCCTCACTGCAGCGAATATCCAACCTATCTTTGCTGTCACCGGTGCAACACTGCCTGTGTATCAG GAGCTGAGA

CAGTTGATTCCCAAGTCTGCTGTCGGGGAGCTGAGTGAGGACTCCAGCAATGTGGTGCAGCTCATCATGGATGCTTATGAT AGCCTGTCATCCACTGTG

ACTCTTGAGCACTCTCCACTCCCACCAGGAGTCAGCATCTCCTTTGAATCTCACTGTAAGGGTCCTGAGAAGACGGAGGGTGAGGCTGGGGACCGGGGAC

AGTGCAATGATGTCCGAGTCAACCAGACG - UNI24701 - GTGGATTTCTGGGTCACTCTTCAAGCTACTCACTGCCTCCCAGAAGCCCACGTCCTA

CGACTCTGGGCTCTTGGCTTCTCAGAGGAGTTAACTGTGGAGCTGCACACAGTGTGCGACTGTAACTGTGGTGATGCCCAGCCTCACGCTCCCTACTGCA

GTGATGGACAGGGGGACCTTCAGTGCGGGATATGCAG - UNI10614 - CTGTGCCCCTGGCCGTCTTGGTCAGCTGTGTGAATGCTCTGAGGCTGAC

CTGTCCTCCCCAGATTTGGAATCTGGTTGCCGGGCCCCAAACGGGACAGGGCCCCTATGCAGCGGGAAGGGTCGATGCCAATGTGGACGCTGCAGCTGCA

GTGGGCAGAGCTCTGGGCGTCTGTGCGAGTGTGATGATGCCAGCTGTGAGCGACATGAGGGCATCCTCTGTGGAG GCTTTGGCCACTGCCAGTGTGGAG

TATGTCACTGTCACGCCAACCACACCGGCAGAGCTTGCGAGTGCAGCAAGAGTGTAGACAGCTGTGTCAGTCCTGAAGGAGGGCTCTGCAGTGGGCACGG

ATACTGCAAATGCAACCGTTGCCAGTGCCTGGATGGCTACTACGGGGCTCTGTGTGACCAGTGCCTAGGCTGCAAGTCACCATGTGAGCAGTACAG GGA

TTGTGCAGAGTGCGGGGCATTTGGTACCGGTCCCCTGGCAGCCAACTGTAGTGTGGTCTGTGCTGACGTGAATGTGACCTTGACCTTGGCCCCTAACTTG

GATGATGGCTGGTGCAAAGAAAGGACAATAGACAACCAGCTGTTCTTCTTCCTGGTGGAGCATGCAGCCAGCGGGATCGTACTGAGAGTGAGACCCCAAG

AGA AGGGAGTGGATCACACCCGTGCCATCATACTGGGCTGCACAGGGGGCATCGTGGCAGTGGGACTAGGGCTGGTTCTGGCTTACCGGCTCTCTGTGG

AAATCTACGACCGACGGGAGTACAGGCGCTTTGAGAAGGAGCAGCAGCAACTCAACTGGAAGCAG GACAACAATCCTCTCTACAAAAGTGCGATCACAA

CCACTGTCAACCCCCGCTTCCAAGGGACAAACGGTCGGTCGCCATCCCTCTCTCTGACCAGGGAAGCAGACTGACTTAGGATTCTTGTCTTGGAGGACAG

TGGAGATAGAAGGGCAGGGCAGCGTCTGTCAGGCAAAGATGCTGCCACCGCTGAGATTTTTCAGAGTGACCTTCAGAGGGCAGCAGCCATTCCCACCACA

CGAAGGGCTGGTCCTTCCATAATAAAGCTTTGCCCC
Translation
 - UNI11884 - - UNI31995 - MVDSSTVLIFLLVLGGGQSELDTKITSSGEAAEWEDPDLSLQGSCQPVPSCQKCILSHPSCAWCKQL - UNI

31995 - NFTASGEAEARRCARREELLARGCPAQELEEPRGRQEVLQDKPLSQGDRGEGATQLAPQRIRVTLRPG - UNI31995 - GEPQKFRVRF

LRAAGYPVDLYYLMDLSYSMKDDLERVRQLGHALLVRLQEVTHSVRIG GFGSFVDKTVLPFVSTVPSKLHHPCPSRLERCQPPFSFHHVLSLTGDAQAF

EREVGRQNVSGNLDSPEGGFDAILQAALCQ EQIGWRNVSRLLVFTSDDTFHTAGDGKLGGIFMPSDGRCHLDSNGVYTNSAEF DYPSVGQVAQALTAA

NIQPIFAVTGATLPVYQ ELRQLIPKSAVGELSEDSSNVVQLIMDAYD SLSSTVTLEHSPLPPGVSISFESHCKGPEKTEGEAGDRGQCNDVRVNQT -

 UNI24701 - VDFWVTLQATHCLPEAHVLRLWALGFSEELTVELHTVCDCNCGDAQPHAPYCSDGQGDLQCGICS - UNI10614 - SCAPGRLGQ

LCECSEADLSSPDLESGCRAPNGTGPLCSGKGRCQCGRCSCSGQSSGRLCECDDASCERHEGILCGG GFGHCQCGVCHCHANHTGRACECSKSVDSCVS

PEGGLCSGHGYCKCNRCQCLDGYYGALCDQCLGCKSPCEQYR RDCAECGAFGTGPLAANCSVVCADVNVTLTLAPNLDDGWCKERTIDNQLFFFLVEHA

ASGIVLRVRPQEK KGVDHTRAIILGCTGGIVAVGLGLVLAYRLSVEIYDRREYRRFEKEQQQLNWKQ DNNPLYKSAITTTVNPRFQGTNGRSPSLSLT

READ

For any suggestions or comments, please send an email to unitrap@crg.es