Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001348 (Acp5)
Chromosomal location
Chr 9: 21931175 - 21936259 (-)
Description
acid phosphatase 5, tartrate resistant Gene [Source:MGI Symbol;Acc:MGI:87883]
RefSeq_dna
NM_007388 
RefSeq_peptide
NP_031414.1 NP_001095874.1 NP_001095875.1 
UniGene
Mm.46354 Mm.399836 
MGI
MGI:87883 
Uniprot/SWISSPROT
Q05117 
Uniprot/SPTREMBL
Q38RM9 
Human Ortholog
ENSG00000102575 (ACP5)
Omim not available
UniTrap UNI27076
Vector Insertion
Chr 9: 21935099 - 21936180
Public Clones IST14632B3 (tigm)
Private Clones OST72860 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17556
Vector Insertion
Chr 9: 21934574 - 21934966
Public Clones not available
Private Clones OST440764 (lexicon) OST407811 (lexicon) OST125728 (lexicon) OST98333 (lexicon)
OST16115 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23091
Vector Insertion
Chr 9: 21934103 - 21934306
Public Clones not available
Private Clones OST276735 (lexicon) OST98318 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115315
Sequence
TCGGAGAAAATGCATCATCTTTCCCAATGATGCACTTCTGCCCCAGAGAATAAAGACTCGGTGATCACCGCTTTTGGTCCAGGAGCTTAACTGCCTCTTG

CAGCCTCTCTGACCACCTGTGCTTCCTCCAGG - UNI17556 - ATGGATTCATGGGTGGTGCTGCTGGGCCTACAAATCATATGGCTCCCACTCCTG

ACCCACGGTACAGCCCCCACTCCCACCCTGAGATTTGTGGCTGTGGGCGACTGGGGAGGGGTCCCCAATGCCCCATTCCACACAGCCCGGGAAATGGCCA

ATGCCAAAGAGATCGCCAGAACCGTGCAGACGATGGGCGCTGACTTCATCATGTCTCTGGGGGACAATTTCTACTTCACTGGAGTGCACGATGCCAGCGA

CAAGAGGTTCCAG - UNI23091 - GAGACCTTTGAGGACGTGTTCTCTGACCGTGCCCTTCGCAACATCCCCTGGTATGTGCTGGCTGGAAACCATG

ATCACCTTGGCAACGTCTCTGCACAGATTGCATACTCTAAGATCTCCAAGCGCTG GAACTTCCCCAGCCCTTACTACCGTTTGCGCTTCAAAATTCCAC

GTACAAACATAACTGTGGCCATCTTTATGCTGGACACAGTGATGCTGTGTGGCAACTCAGATGACTTTGCCAGTCAGCAGCCCAAAATGCCTCGAGACCT

GGGAGTGGCCCGCACTCAGCTGTCCTGGCTCAAAAAGCAGTTGGCAGCAGCCAAGGAGGACTACGTTTTGGTGGCCGGCCACTACCCCATCTGGTCCATC

GCCGAGCACGGACCCACGCGCTGCCTTGTCAAGAACTTGCGACCATTGTTAGCCACATACGGGGTCACTGCCTACCTGTGTGGACATGACCACAACCTGC

AG TATCTTCAGGACGAGAACGGTGTGGGCTATGTGCTGAGTGGGGCCGGCAACTTCATGGATCCCTCTGTGCGACATCAACGAAAGGTCCCCAACGGCT

ACTTGCGGTTTCACTATGGATCTGAGGACTCCCTGGGCGGCTTCACACATGTGGAGATAAGCCCCAAAGAAATGACCATCATATATGTGGAAGCCTCTGG

AAAATCACTCTTTAAGACCAGCCTCCCAAGGAGACCCAGACCCTGAACACCACGAGAGTCCTGCTTGTCCGCTAACGGGTGTGAGGGAGGAGGCGTCTGC

AGGCGTGGTGGGTGGGCCCTGTGAGGACCTCACTCACGGCAGCTTCTCTGCCCTGGTACTCTGGCAGAGAGGGAAGGGGAACCAAGGGGCTTACTTACAG

GAAAGAAGTATGCCCACACCAACTGATCCCACAGCCAGGCTCACCCCTTTTAGGGTAGAGCTTTCTTGGGAACGGGCTTTCCTTTCAGTCAAGTCTTACT

GTCACTGCTATTCAATAAAA
Translation
 - UNI17556 - MDSWVVLLGLQIIWLPLLTHGTAPTPTLRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQTMGADFIMSLGDNFYFTGVHDASDK

RFQ - UNI23091 - ETFEDVFSDRALRNIPWYVLAGNHDHLGNVSAQIAYSKISKRW WNFPSPYYRLRFKIPRTNITVAIFMLDTVMLCGNSDDFA

SQQPKMPRDLGVARTQLSWLKKQLAAAKEDYVLVAGHYPIWSIAEHGPTRCLVKNLRPLLATYGVTAYLCGHDHNLQ YLQDENGVGYVLSGAGNFMDPS

VRHQRKVPNGYLRFHYGSEDSLGGFTHVEISPKEMTIIYVEASGKSLFKTSLPRRPRP
Transcript ENSMUST00000069330
Sequence
ACTCGTGCAGCCCGGAGCGACCCGCCGCGAATCCGCAGCTCAGTTGGGTAGCACAGCTTGTCCTGGACCCACCGCCAAG - UNI17556 - - UNI27

076 - ATGGATTCATGGGTGGTGCTGCTGGGCCTACAAATCATATGGCTCCCACTCCTGACCCACGGTACAGCCCCCACTCCCACCCTGAGATTTGTGG

CTGTGGGCGACTGGGGAGGGGTCCCCAATGCCCCATTCCACACAGCCCGGGAAATGGCCAATGCCAAAGAGATCGCCAGAACCGTGCAGACGATGGGCGC

TGACTTCATCATGTCTCTGGGGGACAATTTCTACTTCACTGGAGTGCACGATGCCAGCGACAAGAGGTTCCAG - UNI23091 - GAGACCTTTGAGG

ACGTGTTCTCTGACCGTGCCCTTCGCAACATCCCCTGGTATGTGCTGGCTGGAAACCATGATCACCTTGGCAACGTCTCTGCACAGATTGCATACTCTAA

GATCTCCAAGCGCTG GAACTTCCCCAGCCCTTACTACCGTTTGCGCTTCAAAATTCCACGTACAAACATAACTGTGGCCATCTTTATGCTGGACACAGT

GATGCTGTGTGGCAACTCAGATGACTTTGCCAGTCAGCAGCCCAAAATGCCTCGAGACCTGGGAGTGGCCCGCACTCAGCTGTCCTGGCTCAAAAAGCAG

TTGGCAGCAGCCAAGGAGGACTACGTTTTGGTGGCCGGCCACTACCCCATCTGGTCCATCGCCGAGCACGGACCCACGCGCTGCCTTGTCAAGAACTTGC

GACCATTGTTAGCCACATACGGGGTCACTGCCTACCTGTGTGGACATGACCACAACCTGCAG TATCTTCAGGACGAGAACGGTGTGGGCTATGTGCTGA

GTGGGGCCGGCAACTTCATGGATCCCTCTGTGCGACATCAACGAAAGGTCCCCAACGGCTACTTGCGGTTTCACTATGGATCTGAGGACTCCCTGGGCGG

CTTCACACATGTGGAGATAAGCCCCAAAGAAATGACCATCATATATGTGGAAGCCTCTGGAAAATCACTCTTTAAGACCAGCCTCCCAAGGAGACCCAGA

CCCTGAACACCACGAGAGTCCTGCTTGTCCGCTAACGGGTGTGAGGGAGGAGGCGTCTGCAGGCGTGGTGGGTGGGCCCTGTGAGGACCTCACTCACGGC

AGCTTCTCTGCCCTGGTACTCTGGCAGAGAGGGAAGGGGAACCAAGGGGCTTACTTACAGGAAAGAAGTATGCCCACACCAACTGATCCCACAGCCAGGC

TCACCCCTTTTAGGGTAGAGCTTTCTTGGGAACGGGCTTTCCTTTCAGTCAAGTCTTACTGTCACTGCTATTCAATAAAACAATGCTTTGTCTCC
Translation
 - UNI17556 - - UNI27076 - MDSWVVLLGLQIIWLPLLTHGTAPTPTLRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQTMGADFIMSLGD

NFYFTGVHDASDKRFQ - UNI23091 - ETFEDVFSDRALRNIPWYVLAGNHDHLGNVSAQIAYSKISKRW WNFPSPYYRLRFKIPRTNITVAIFML

DTVMLCGNSDDFASQQPKMPRDLGVARTQLSWLKKQLAAAKEDYVLVAGHYPIWSIAEHGPTRCLVKNLRPLLATYGVTAYLCGHDHNLQ YLQDENGVG

YVLSGAGNFMDPSVRHQRKVPNGYLRFHYGSEDSLGGFTHVEISPKEMTIIYVEASGKSLFKTSLPRRPRP

For any suggestions or comments, please send an email to unitrap@crg.es