Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001415 (Smg5)
Chromosomal location
Chr 3: 88140182 - 88166259 (+)
Description
Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans) Gene [Source:MGI Symbol;Acc:MGI:2447364]
RefSeq_dna
NM_178246 
RefSeq_peptide
NP_839977.2 
UniGene
Mm.439830 
MGI
MGI:2447364 
Uniprot/SWISSPROT
Q6ZPY2 
Uniprot/SPTREMBL
Q3U1Q7 Q3UZS1 
Human Ortholog
ENSG00000198952 (SMG5)
Omim not available
UniTrap UNI5320
Vector Insertion
Chr 3: 88140420 - 88145779
Public Clones (sanger) XH037 (baygenomics) SYA313 (baygenomics) W058B05 (ggtc)
3SD010E11 (ggtc) E076D03 (ggtc) W193C04 (ggtc) M125E01 (ggtc) M065D08 (ggtc)
5SD010E11 (ggtc) E123A09 (ggtc) IST14305A4 (tigm) IST14426F6 (tigm)
Private Clones OST217843 (lexicon) OST207630 (lexicon) OST197539 (lexicon) OST186595 (lexicon)
OST184017 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37281
Vector Insertion
Chr 3: 88145879 - 88146362
Public Clones CMHD-GT_461A12-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21929
Vector Insertion
Chr 3: 88146487 - 88146801
Public Clones not available
Private Clones OST313977 (lexicon) OST257262 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5460
Vector Insertion
Chr 3: 88146959 - 88149284
Public Clones CSJ202 (baygenomics)
Private Clones OST287821 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI227
Vector Insertion
Chr 3: 88149375 - 88150366
Public Clones GC0669 (tigem) CSJ201 (baygenomics) A067E07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7364
Vector Insertion
Chr 3: 88157061 - 88157797
Public Clones RRU351 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8897
Vector Insertion
Chr 3: 88159659 - 88162574
Public Clones XL033 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000001451
Sequence
GATAGGTGGAGGAGGAGCCATCTCAGGCAGCCGCCTCACAGCGATGGCGGCCGAGCAGGGCCGGCGGCAGTGGCGGCTGCGGGTACAGCTGGAGACGGCA

GTGGAGGCGCCAGTGGTGGGTGGCGGGGGCCTGTGACCAGGAGGTGCCCTCGGGCCCAGGCACCATGAGCCAAGGCCCTCCTCCAGGGGAGAGCAGCGAA

CCCGAGGCAAAGGTCCTCCACACCAAGCGGCTTTACCG - UNI5320 - GGCTGTGGTGGAGGCTGTGCATCGGCTAGATCTCATCCTTTGCAACAAA

GCTGCTTATCAGGAAGTGTTCAAACCAGAGAACGTTAGCCTGAGGAACAA GCTACGAGAGCTCTGTGTGAAGCTTATGTTCTTGCATCCAGTAGACTAT

GGGAGGAAGGCTGAGGAACTGCTGTGGAGAAAGGTATACTATGAAGTTATCCAACTTATCAAGACTAACAAAAAG - UNI21929 - CACATCCACAG

TCGGAGCACCTTGGAATGTGCCTACAGGACTCATCTGGTCGCTGGCATTGGCTTCTACCAGCATCTCCTTCTCTATATCCAGTCCCACTACCAGCTGGAA

CTACAGTGCTGCATCGACTGGACTCACGTCACCGATCCCCTCATGG - UNI5460 - GATTCAAGAAGCCAGTATCTGCTTCAGGAAAGGAGATGGAT

TGGGCACAAATGGCTTGCCACCGATGCCTGGTGTACCTGGGGGATCTGT - UNI227 - CACGCTATCAGAATGAGTTGGCTGGTGTGGACACCGAGC

TGCTAGCTGAGAGATTCTACTATCAAGCCTTGTCAGTGGCTCCCCAGATTG GAATGCCCTTCAACCAGCTGGGTACCCTTGCAGGCAGCAAGTATTACA

ACGTGGAAGCCATGTATTGCTACTTGCGCTG CATCCAGTCGGAAGTGTCCTTTGAGGGAGCCTATGGGAACCTCAAGAGACTATATGACAAGGCAGCCA

AAATGTACCACCAGTTGAAGAAGTCTGAGACCAGGAAGCTCTCCCCTAGCAAAAAGCG ATGCAAAGACATTAAGAGGTTGTTGGTGAACTTCATGTACC

TACAAAGCCTGTTACAGCCCAAAAGTAG CTCCGTGGACTCAGAACTGACCTCACTCTGCCAGTCAGTCCTAGAGGATTTCAACCTCTGCCTCTTCTACC

TGCCCTCCTCACCCAACCTTGGTCTAACCAACGAGGATGAGGAGGAGTGTGAAAGTGGATATGCTTTCCTCCCCGACCTGCTCATCTTTCAGATGGCCAT

CATCTGCCTCATGGGTGTGCACAGTTTAAAGAGAGCAG GATCCAAGCATTATAGTGCAGCCATTGCTTTCACCCTGGCCCTCTTTTCCCACCTTATCAA

TCATGTCAACATACGGCTGCAGGCGGAACTGGAAGAGGGCGAGAACCCTGTCTCAGCTTTTCAGAGTGATGGCACAG ATGAACCAGAGTCAAAAGAAGC

ACTAGAAAAAGAGGAGCCAGAGCCTGAGCCTCCCACTGTGGTACCCCAAGCTGATGAGGGCAGAAAGAGCCGTAAGCACTCCCGACTCTCTTGTCTACGT

CGTCGCCGCCGCCACCATCCTCCTAAAGCTGGTGATGACAGTGACCTGAGTGAGGGTTTTGAATCTGACTCTAGCCATGACTCTGCCCAGGCCAGTGACG

GCTCAGACAGTGGCTCTGATAAGAGCCTGGAAGGCAGGGGCACTGCTTTTGATGCAGAGACAGACTCAGAAATGAACAGCCAGGAGTCCCGGTCAGACCT

GGAAGATATGGAGGATGAGGAGGGGACAAGATCTCCAGCCCAGGAGCCCCCTCAGGCCAGATCAGAGGTTCCAGATTCCCTCAATGGCCCCCTGGGCCCC

AGTGAAGCAAGCATTGCCAGCAATTTACAAGCCATGTCCACCCAGATGTTCCAGACCAAGCGCTGCTTCCGACTGGCTCCCACTTTCAGCAACCTGCTCC

TGCAGCCCACCACGGAACCTAACAGTGTGGCCAGTCACAGGCCTTGTGTCAACGGGGATATGGACAAGCCTTTAGAACCAG CCTCTGAGGATGGCTCCG

AGTCAGAGGGGAGCGAGTCCAGCAACCGCTCCTGTCGCAACGAGCGCAGCCTTCAGGAGAAGCTGCAGGCCCTGATGGCTGAGGGCCTCCTTCCTGCTGT

GAAGGTCTTCCTGGACTGGCTGCGAACCAACCCTGACCTCATCATCGTGTGTGCACAG - UNI7364 - AGCTCTCAAAGTTTGTGGAACCGCCTGTC

TGTGTTGCTGAATCTGTTGCCAGCATCTGCTGAGCTCCAGGATTCTG GCCTGGCTCTGTGTTCCGAAGTCCAAGGTCTCCTTGAAGGCTGCGAGCTGCC

TGACCTCCCTGCCAGCCTGCTGCTCCCAGAGGACATGGCACTGCGTAACCTACCTCCTCTGCGGGCTGCTCATAGACGCTTTAACTTTGACGCAGATCGG

CCCCTGCTCAGTGCTTTAGAGGAG TCGGTGGTGCGCATCTGCTGTATCCGCAGCTTTGGGCACTTTGTTGCTCGCTTACAAGGCAGCATCCTGCAGTTC

AATCCAGAGGTCGGCATCTTCGTCAGCATTGCTCAGTCTGAGCAGGAGAGCCTGCTGCAGCAGGCCCAGGCCCAGTTTCGTATG - UNI8897 - GCA

GAGGAGGAGGCTCGGCGGAACAGGCTCATGAGAGACATGGCTCAGCTACGATTACAG CTCGAGGTCTCCCAACTGGAAGGGAGCCTACAGCAGCCCAAA

GCTCAGTCAGCCATGTCTCCCTACCTCATCCCTGACACCCAGGCCCTCTGCTACCACCTCCCTCTTATCCGCCAGCTTGCCACCAGTGGCCGCTTCATCA

TCATCATTCCAAGGACAG TGATTGATGGCCTGGATTTGCTGAAGAAAGAACAGCCAGGGGCCAGGGATGGCATCCGGTACCTGGAGGCAGAGTTTAAAA

AGGGAAACAG ATACATTCGCTGCCAGAAGGAGGTGGGAAAGAGCTTTGAGCGGCATAAACTGAAGAGGCAGGATGCAGATGCCTG GACTCTCTATAAG

ATCCTGGACAGCTGCAGACAGCTAACTCTGGCCCAGGGGGCAGGGGAGGAGGACCCAAGTGGCATGGTGACCATTATCACAGGCCTTCATTTGGACAGCC

CCAGTGCACTCTCTGGGCCCATGCAG GCTGCCCTGCAAGCTGCTGCCCATGCCAGTGTGGACGTCAAGAACGTTCTAGACTTCTACAGGCAGTGGAAGG

AGATTGGTTGAGACTGGTCTCCAGGCCCTGCCGTGGGGCTGACTCCAGATTTCTCCTGTTCTCCCTGGCGACCAGGACCACCACCTGTAGTCACCCCACC

ACATGCAGACTCAAGCAGGCAAACAGGAAGGAAGGCCAGCTGCACTGAGGCTGCAGGGAGGGCCCAGGAGCCAGCGGGGAGGATGGGGGCCCCTGTTGCC

AAGGCGAAATCAGGAAAGTGAGGAAGTGCTTGGCGTAGGAGTGGCCATGGACCCCCGGCCAGCCTTCCACCTTAAACCTGCAGTCCCCAGGGGCATGGGC

AGGGGCAGGCATGGGGGTCTGCATTTCATTGGAGCAGTTCCTGGACTTCTGAGAGGAAAAGATGACAGAAGGGCCCTGTCCTCACCCAAGATTCAGGGTG

GGTGGGGCTGGGAGTTTGGAGCCCCTAGCTCTTAGGGAAGAGTGGGGAGATACTGAGTGTCTGCATGGTTCTCTGCAGACCCCACCCATCCTCAAGGACC

CCCTCATCCCTTGTCTCCCATGGGGAACAGGGCAGCTCTAGAGCCAGCTGTGGGGGCTCTTAGGGAAGCAGGGTCTGCACACTTGGAGGCCCCACTTCTC

CTCTGCTGCTGCCCAGCTTCCAGGCCCACTTAGGGTGTGGGCTGGATGGCTGTACACCAGCAGTCATCCCTTCCCCACCAGCAGTCACTGTGCTTTGTGC

TCTTGGCTGCTGTACTGGATAAGGGGTGCCAATGAGGGAGCGAAGGCCAAGGCCACCCCTCTGACCATCCAGGGAGAGCTGGAGGAAGGGTGGCAGAGGG

GCAAGGTCCCTGGGAGCTGCTTACTTAGGGCCCTCCTCCATCCTAGACTACCCTCCTTTTGCCCACCCCCAGAACTAGAGCCCTGGTAGGCTGAGCACAG

GCTGGTTTTGGAGTGTCAAATGACACAGGAGCAGAGATCATGAATACTCAGGGGCAGAGTAGCACCCTGAGAGCAGAGCTATAGGAGAGGCTCTGGCCAG

GACGACCCCAGTTCTACCCCTCAGGCTGGAAGCAGAGCATAGCTGGGGCTGGGTTCTTTTCTGCTTCCCCCTCCTTGCCCCAACTGGCCTAGCTGCTTTG

GCTGTGCTTAAGAGGAGCTGGCTTCCAGCCTTCCACTAAGAAAGAAGGTCTGGGAAAACCAGGGAACAGTTGGGGTTACCACATTTCCAATTCTGGCAGA

CTTGAGACTCAAGCTTAATAAAGACCCCCTTCCCAAGTGC
Translation
MSQGPPPGESSEPEAKVLHTKRLYR - UNI5320 - RAVVEAVHRLDLILCNKAAYQEVFKPENVSLRNK KLRELCVKLMFLHPVDYGRKAEELLWR

KVYYEVIQLIKTNKK - UNI21929 - HIHSRSTLECAYRTHLVAGIGFYQHLLLYIQSHYQLELQCCIDWTHVTDPLMG - UNI5460 - GFKKP

VSASGKEMDWAQMACHRCLVYLGDLS - UNI227 - SRYQNELAGVDTELLAERFYYQALSVAPQIG GMPFNQLGTLAGSKYYNVEAMYCYLRC CI

QSEVSFEGAYGNLKRLYDKAAKMYHQLKKSETRKLSPSKKR RCKDIKRLLVNFMYLQSLLQPKSS SSVDSELTSLCQSVLEDFNLCLFYLPSSPNLGL

TNEDEEECESGYAFLPDLLIFQMAIICLMGVHSLKRAG GSKHYSAAIAFTLALFSHLINHVNIRLQAELEEGENPVSAFQSDGTD DEPESKEALEKEE

PEPEPPTVVPQADEGRKSRKHSRLSCLRRRRRHHPPKAGDDSDLSEGFESDSSHDSAQASDGSDSGSDKSLEGRGTAFDAETDSEMNSQESRSDLEDMED

EEGTRSPAQEPPQARSEVPDSLNGPLGPSEASIASNLQAMSTQMFQTKRCFRLAPTFSNLLLQPTTEPNSVASHRPCVNGDMDKPLEPA ASEDGSESEG

SESSNRSCRNERSLQEKLQALMAEGLLPAVKVFLDWLRTNPDLIIVCAQ - UNI7364 - SSQSLWNRLSVLLNLLPASAELQDSG GLALCSEVQGL

LEGCELPDLPASLLLPEDMALRNLPPLRAAHRRFNFDADRPLLSALEE SVVRICCIRSFGHFVARLQGSILQFNPEVGIFVSIAQSEQESLLQQAQAQF

RM - UNI8897 - AEEEARRNRLMRDMAQLRLQ LEVSQLEGSLQQPKAQSAMSPYLIPDTQALCYHLPLIRQLATSGRFIIIIPRTV VIDGLDLLK

KEQPGARDGIRYLEAEFKKGNR RYIRCQKEVGKSFERHKLKRQDADAW WTLYKILDSCRQLTLAQGAGEEDPSGMVTIITGLHLDSPSALSGPMQ AA

LQAAAHASVDVKNVLDFYRQWKEIG

For any suggestions or comments, please send an email to unitrap@crg.es