Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001420 (Tmem79)
Chromosomal location
Chr 3: 88132966 - 88138385 (-)
Description
transmembrane protein 79 Gene [Source:MGI (curated);Acc:Tmem79-001]
RefSeq_dna
NM_024246 
RefSeq_peptide
NP_077208.1 
UniGene
Mm.34256 
MGI
MGI:1919163 
Uniprot/SWISSPROT
Q9D709 
Human Ortholog
ENSG00000163472 (TMEM79)
Omim not available
UniTrap UNI32401
Vector Insertion
Chr 3: 88138029 - 88138377
Public Clones IST14929F2 (tigm) IST15097B8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25147
Vector Insertion
Chr 3: 88136813 - 88137605
Public Clones not available
Private Clones OST193938 (lexicon) OST126935 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20800
Vector Insertion
Chr 3: 88136576 - 88136813
Public Clones not available
Private Clones OST351915 (lexicon)
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14067
Vector Insertion
Chr 3: 88133855 - 88136361
Public Clones CMHD-GT_142C12-3 (cmhd) IST11001E10 (tigm) IST11722H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107552
Sequence
GAAATACTTGCAGAGCCAGCCAGGAGCTAGGCAGCTCCTTTCCGGAGATCCTCCGCCTCTTTGCAGATGGAAA - UNI32401 - TCCCATGAGGCCA

GCTTCTCTGGGGAGTTCTAGGTCTGAGAAACTGTCCTGGGGCCAGAAGACTAGGTATTCTCACAGAACTTCTCCCACTGCCTATAGGATGACATCGTTCT

GTGGTAGCCCTCGGAACTGAAGCCTCACAATGACAGAACCGGAGACACTGGCCCTGCTGGACATGAAGGAACCCGAGACTCCAGAGAAGAGCCCACCGCA

GGCTTTAGTCCTGCAGTCAGAGGAAGAAGGTGGGACTGAGTCCCCTGGAACTGAGTCGCTCAGAGTGGGGTCTTCAGTAGGGTCTCCTATAGTCAGAGAG

GGGCCTGAGGATGGTCCAGACAGCACAATAAGTGAGGCTGCCACTTTACCCTGGGGAACTGACCCCCATCCTAGCGCCCCACTTCCGGATCCCCCGGGCT

GGCGAGATATTGAACCAGAGCCCCTAGAGTCAGAGGCACCTACTAAGTCGGAGGAGCCATTCAAAGAGGATGCCAACCTGCTCCCCGAGAAGACAGTTAG

GGCCTTCGTGCCCATTGATCTACAGTGCATCGAGCGGAAGCCACAGGAGGAGCGCATCCTGCATCGCGACGCTGGACCAGGCGAGCTCAGGAATTTCCTG

CCAGCTCGACTCAGCCACCCTGAGCCCCCAGAGCGCAAGTGGGCTGAGGCCGTGGTGAGACCCCCTGGCCGGTCCTGCGGGGGCTGTGGAAGCTGTGGAG

GTCGTGAGGCACTGAGAGCTGTCGCCTCGGTGGTGGCGGCCCTCATCTTCTTCCCCTGTCTGCTGTACGGAGCATACGCCTTCCTGCCTTTCGATGCCCC

GAGGCTGCCCACCATGAGCTCCCGCTTGGTTTACACCCTTCGCTGTGGGGTCTTTGCCACCTTTCCCATCGTACTCG - UNI20800 - - UNI2514

7 - GGCTCCTTGTGTACGGGCTGAGCCTATTGTGCTTTTCTGCGCTTCGGCCCTTCGGCGAGCCGAGGCGGGAAGTGGAGATCCACCGGCAGTACGTGG

CCCAGTCTGTGCAGCTCTTCATCCTCTACTTCTTTAACCTGGCTGTGCTTTCCACCTATCTGCCCCAGGACACCCTCAAGCTGCTCCCGCTGCTCACCGG

TCTCTTTGCCATATCTCG - UNI14067 - GCTGATATACTGGTTGACCTTTGCTGTGGGCCGCTCCTTCCGAGGCTTTGGCTATGGCCTGACTTTCC

TGCCACTCTTGGCCATGCTGGTGTGGAACCTCTATTACATGTTTGTGGTGGAGCCAGAGCGCATGCTCACTGCCTCCGAGAGCCGCTTGGACTACCCTGA

CCATGCTCGGTCTGTTTCCGACTACAGGCCCCGCTCATGGGGCTGAGCCACCTAGAGCTGCACAGGGGGCTTTCGGCACTTCCCTGGAACAGTTGTAGGC

CTGGCCTTTGCCCAGGCAATGGACCTTTGATGCGAGGAACCTTGCTACTTCCCCACTGGGGCCCCAAATACCCTTACTCTCTCCTAGCCGCTGCTTTACA

AACCCAGAGGATGAGAGCCCAAGGTCGAGACTGGAGAAGCACACTTCCTTCTTGGGCAGCTTCCCACCATGGCACAGGTGCTATGGCGGGATGGTCATCT

CACTCCCTAGCTTCCTGTGGGTCAGGAGTGCAGAGCCACAGCCCACCCTGAACTGTCTGTGCCAGTGAGCGCCAAGGAGAAGGAAAACCTGCCTTAGCCC

GAGGGTAGAAGTTGATGTCATGTCAGATAGTTGGTGAAGACCTTTCTAGGGGGCCTGGTTCTGGACCCGCTACCACTGGCCTCAAGACTCTTTTGCCTCA

GTCAAGACTGTTATATGTAGCTGTTGTCTTTCCTGTCCCAACCTACACGGGTCTCTGTAACATTCCACTATTCAAACTTCCAAGGAGTCCCACTCTCAGG

GGGCGGGGCACAGAGCTAAAATCTCCAAAAGAACTGGGTGTGAACTCACATGGTGGCTAGGAAGGCAGAGCGCCCTCAGCCCAGCATATAGCTGTGAGTA

TGTAATAAATCACTGCCA
Translation
 - UNI32401 - MTEPETLALLDMKEPETPEKSPPQALVLQSEEEGGTESPGTESLRVGSSVGSPIVREGPEDGPDSTISEAATLPWGTDPHPSAPLP

DPPGWRDIEPEPLESEAPTKSEEPFKEDANLLPEKTVRAFVPIDLQCIERKPQEERILHRDAGPGELRNFLPARLSHPEPPERKWAEAVVRPPGRSCGGC

GSCGGREALRAVASVVAALIFFPCLLYGAYAFLPFDAPRLPTMSSRLVYTLRCGVFATFPIVLG - UNI20800 - - UNI25147 - GLLVYGLSL

LCFSALRPFGEPRREVEIHRQYVAQSVQLFILYFFNLAVLSTYLPQDTLKLLPLLTGLFAISR - UNI14067 - RLIYWLTFAVGRSFRGFGYGLTF

LPLLAMLVWNLYYMFVVEPERMLTASESRLDYPDHARSVSDYRPRSWG
Transcript ENSMUST00000107553
Sequence
GAAGGCTTGGGAACGGCCACACTAGAGCTGGGAGTCTGAGTGGAGCCCAGCCCAGCTGAATCGGGTGAGACTGGCAATGGGAGAGTTCAGAAAATGACCG

ACTCCTGGAATGGAGACTGAGGAACCGAGATCTGGTGTCGAGTTCCTGGAGGGACCTGCAG - UNI25147 - - UNI32401 - GATGACATCGTT

CTGTGGTAGCCCTCGGAACTGAAGCCTCACAATGACAGAACCGGAGACACTGGCCCTGCTGGACATGAAGGAACCCGAGACTCCAGAGAAGAGCCCACCG

CAGGCTTTAGTCCTGCAGTCAGAGGAAGAAGGTGGGACTGAGTCCCCTGGAACTGAGTCGCTCAGAGTGGGGTCTTCAGTAGGGTCTCCTATAGTCAGAG

AGGGGCCTGAGGATGGTCCAGACAGCACAATAAGTGAGGCTGCCACTTTACCCTGGGGAACTGACCCCCATCCTAGCGCCCCACTTCCGGATCCCCCGGG

CTGGCGAGATATTGAACCAGAGCCCCTAGAGTCAGAGGCACCTACTAAGTCGGAGGAGCCATTCAAAGAGGATGCCAACCTGCTCCCCGAGAAGACAGTT

AGGGCCTTCGTGCCCATTGATCTACAGTGCATCGAGCGGAAGCCACAGGAGGAGCGCATCCTGCATCGCGACGCTGGACCAGGCGAGCTCAGGAATTTCC

TGCCAGCTCGACTCAGCCACCCTGAGCCCCCAGAGCGCAAGTGGGCTGAGGCCGTGGTGAGACCCCCTGGCCGGTCCTGCGGGGGCTGTGGAAGCTGTGG

AGGTCGTGAGGCACTGAGAGCTGTCGCCTCGGTGGTGGCGGCCCTCATCTTCTTCCCCTGTCTGCTGTACGGAGCATACGCCTTCCTGCCTTTCGATGCC

CCGAGGCTGCCCACCATGAGCTCCCGCTTGGTTTACACCCTTCGCTGTGGGGTCTTTGCCACCTTTCCCATCGTACTCG - UNI20800 - - UNI25

147 - GGCTCCTTGTGTACGGGCTGAGCCTATTGTGCTTTTCTGCGCTTCGGCCCTTCGGCGAGCCGAGGCGGGAAGTGGAGATCCACCGGCAGTACGT

GGCCCAGTCTGTGCAGCTCTTCATCCTCTACTTCTTTAACCTGGCTGTGCTTTCCACCTATCTGCCCCAGGACACCCTCAAGCTGCTCCCGCTGCTCACC

GGTCTCTTTGCCATATCTCG - UNI14067 - GCTGATATACTGGTTGACCTTTGCTGTGGGCCGCTCCTTCCGAGGCTTTGGCTATGGCCTGACTTT

CCTGCCACTCTTGGCCATGCTGGTGTGGAACCTCTATTACATGTTTGTGGTGGAGCCAGAGCGCATGCTCACTGCCTCCGAGAGCCGCTTGGACTACCCT

GACCATGCTCGGTCTGTTTCCGACTACAGGCCCCGCTCATGGGGCTGAGCCACCTAGAGCTGCACAGGGGGCTTTCGGCACTTCCCTGGAACAGTTGTAG

GCCTGGCCTTTGCCCAGGCAATGGACCTTTGATGCGAGGAACCTTGCTACTTCCCCACTGGGGCCCCAAATACCCTTACTCTCTCCTAGCCGCTGCTTTA

CAAACCCAGAGGATGAGAGCCCAAGGTCGAGACTGGAGAAGCACACTTCCTTCTTGGGCAGCTTCCCACCATGGCACAGGTGCTATGGCGGGATGGTCAT

CTCACTCCCTAGCTTCCTGTGGGTCAGGAGTGCAGAGCCACAGCCCACCCTGAACTGTCTGTGCCAGTGAGCGCCAAGGAGAAGGAAAACCTGCCTTAGC

CCGAGGGTAGAAGTTGATGTCATGTCAGATAGTTGGTGAAGACCTTTCTAGGGGGCCTGGTTCTGGACCCGCTACCACTGGCCTCAAGACTCTTTTGCCT

CAGTCAAGACTGTTATATGTAGCTGTTGTCTTTCCTGTCCCAACCTACACGGGTCTCTGTAACATTCCACTATTCAAACTTCCAAGGAGTCCCACTCTCA

GGGGGCGGGGCACAGAGCTAAAATCTCCAAAAGAACTGGGTGTGAACTCACATGGTGGCTAGGAAGGCAGAGCGCCCTCAGCCCAGCATATAGCTGTGAG

TATGTAATAAATCACTGCCAG
Translation
 - UNI25147 - - UNI32401 - MTEPETLALLDMKEPETPEKSPPQALVLQSEEEGGTESPGTESLRVGSSVGSPIVREGPEDGPDSTISEAATL

PWGTDPHPSAPLPDPPGWRDIEPEPLESEAPTKSEEPFKEDANLLPEKTVRAFVPIDLQCIERKPQEERILHRDAGPGELRNFLPARLSHPEPPERKWAE

AVVRPPGRSCGGCGSCGGREALRAVASVVAALIFFPCLLYGAYAFLPFDAPRLPTMSSRLVYTLRCGVFATFPIVLG - UNI20800 - - UNI2514

7 - GLLVYGLSLLCFSALRPFGEPRREVEIHRQYVAQSVQLFILYFFNLAVLSTYLPQDTLKLLPLLTGLFAISR - UNI14067 - RLIYWLTFAV

GRSFRGFGYGLTFLPLLAMLVWNLYYMFVVEPERMLTASESRLDYPDHARSVSDYRPRSWG
Transcript ENSMUST00000001456
Sequence
GGAAACTGGGAAATACTTGCAGAGCCAGCCAGGAGCTAGGCAGCTCCTTTCCGGAGATCCTCCGCCTCTTTGCAGATGGAAA - UNI25147 - - UN

I32401 - GATGACATCGTTCTGTGGTAGCCCTCGGAACTGAAGCCTCACAATGACAGAACCGGAGACACTGGCCCTGCTGGACATGAAGGAACCCGAG

ACTCCAGAGAAGAGCCCACCGCAGGCTTTAGTCCTGCAGTCAGAGGAAGAAGGTGGGACTGAGTCCCCTGGAACTGAGTCGCTCAGAGTGGGGTCTTCAG

TAGGGTCTCCTATAGTCAGAGAGGGGCCTGAGGATGGTCCAGACAGCACAATAAGTGAGGCTGCCACTTTACCCTGGGGAACTGACCCCCATCCTAGCGC

CCCACTTCCGGATCCCCCGGGCTGGCGAGATATTGAACCAGAGCCCCTAGAGTCAGAGGCACCTACTAAGTCGGAGGAGCCATTCAAAGAGGATGCCAAC

CTGCTCCCCGAGAAGACAGTTAGGGCCTTCGTGCCCATTGATCTACAGTGCATCGAGCGGAAGCCACAGGAGGAGCGCATCCTGCATCGCGACGCTGGAC

CAGGCGAGCTCAGGAATTTCCTGCCAGCTCGACTCAGCCACCCTGAGCCCCCAGAGCGCAAGTGGGCTGAGGCCGTGGTGAGACCCCCTGGCCGGTCCTG

CGGGGGCTGTGGAAGCTGTGGAGGTCGTGAGGCACTGAGAGCTGTCGCCTCGGTGGTGGCGGCCCTCATCTTCTTCCCCTGTCTGCTGTACGGAGCATAC

GCCTTCCTGCCTTTCGATGCCCCGAGGCTGCCCACCATGAGCTCCCGCTTGGTTTACACCCTTCGCTGTGGGGTCTTTGCCACCTTTCCCATCGTACTCG

 - UNI20800 - - UNI25147 - GGCTCCTTGTGTACGGGCTGAGCCTATTGTGCTTTTCTGCGCTTCGGCCCTTCGGCGAGCCGAGGCGGGAAGT

GGAGATCCACCGGCAGTACGTGGCCCAGTCTGTGCAGCTCTTCATCCTCTACTTCTTTAACCTGGCTGTGCTTTCCACCTATCTGCCCCAGGACACCCTC

AAGCTGCTCCCGCTGCTCACCGGTCTCTTTGCCATATCTCG - UNI14067 - GCTGATATACTGGTTGACCTTTGCTGTGGGCCGCTCCTTCCGAGG

CTTTGGCTATGGCCTGACTTTCCTGCCACTCTTGGCCATGCTGGTGTGGAACCTCTATTACATGTTTGTGGTGGAGCCAGAGCGCATGCTCACTGCCTCC

GAGAGCCGCTTGGACTACCCTGACCATGCTCGGTCTGTTTCCGACTACAGGCCCCGCTCATGGGGCTGAGCCACCTAGAGCTGCACAGGGGGCTTTCGGC

ACTTCCCTGGAACAGTTGTAGGCCTGGCCTTTGCCCAGGCAATGGACCTTTGATGCGAGGAACCTTGCTACTTCCCCACTGGGGCCCCAAATACCCTTAC

TCTCTCCTAGCCGCTGCTTTACAAACCCAGAGGATGAGAGCCCAAGGTCGAGACTGGAGAAGCACACTTCCTTCTTGGGCAGCTTCCCACCATGGCACAG

GTGCTATGGCGGGATGGTCATCTCACTCCCTAGCTTCCTGTGGGTCAGGAGTGCAGAGCCACAGCCCACCCTGAACTGTCTGTGCCAGTGAGCGCCAAGG

AGAAGGAAAACCTGCCTTAGCCCGAGGGTAGAAGTTGATGTCATGTCAGATAGTTGGTGAAGACCTTTCTAGGGGGCCTGGTTCTGGACCCGCTACCACT

GGCCTCAAGACTCTTTTGCCTCAGTCAAGACTGTTATATGTAGCTGTTGTCTTTCCTGTCCCAACCTACACGGGTCTCTGTAACATTCCACTATTCAAAC

TTCCAAGGAGTCCCACTCTCAGGGGGCGGGGCACAGAGCTAAAATCTCCAAAAGAACTGGGTGTGAACTCACATGGTGGCTAGGAAGGCAGAGCGCCCTC

AGCCCAGCATATAGCTGTGAGTATGTAATAAATCACTGCCAGGC
Translation
 - UNI25147 - - UNI32401 - MTEPETLALLDMKEPETPEKSPPQALVLQSEEEGGTESPGTESLRVGSSVGSPIVREGPEDGPDSTISEAATL

PWGTDPHPSAPLPDPPGWRDIEPEPLESEAPTKSEEPFKEDANLLPEKTVRAFVPIDLQCIERKPQEERILHRDAGPGELRNFLPARLSHPEPPERKWAE

AVVRPPGRSCGGCGSCGGREALRAVASVVAALIFFPCLLYGAYAFLPFDAPRLPTMSSRLVYTLRCGVFATFPIVLG - UNI20800 - - UNI2514

7 - GLLVYGLSLLCFSALRPFGEPRREVEIHRQYVAQSVQLFILYFFNLAVLSTYLPQDTLKLLPLLTGLFAISR - UNI14067 - RLIYWLTFAV

GRSFRGFGYGLTFLPLLAMLVWNLYYMFVVEPERMLTASESRLDYPDHARSVSDYRPRSWG

For any suggestions or comments, please send an email to unitrap@crg.es