Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001436 (Slc19a1)
Chromosomal location
Chr 10: 76496004 - 76513171 (+)
Description
solute carrier family 19 (sodium/hydrogen exchanger), member 1 Gene [Source:MGI Symbol;Acc:MGI:103182]
RefSeq_dna
NM_031196 
RefSeq_peptide
NP_112473.1 
UniGene
Mm.265060 
MGI
MGI:103182 
Uniprot/SWISSPROT
P41438 
Uniprot/SPTREMBL
Q542F3 Q9DCR3 
Human Ortholog
ENSG00000173638 (SLC19A1)
Omim not available
UniTrap UNI17465
Vector Insertion
Chr 10: 76496093 - 76501094
Public Clones IST14640H3 (tigm)
Private Clones OST442237 (lexicon) OST288389 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000092387
Sequence
GTGTGCGCGTTGAATCAGCCACAGGCCTGTGGGACGCAGAGCTAGGAATCCATTCTATGCGTGCCTGGGGAGCCACGGGGTAGTGCAAG - UNI17465

 - GTGGAGTGTCATCTTGGCCCGCCAGTTCCCATGAGGACCTGGGCAACATGGTGCCCACTGGCCAGGTGGCAGAAAAGCAGGCATACGAAGAGCCCAG

GCAGGACCACGAACTGAAATCCTGGCGATGCCTGGTGTTCTATCTCTGCTTCTTCGGCTTCATGGCCCAGTTGCGTCCTGGGGAAAGCTTCATCACACCC

TTCCTCCTGGAACGTAAATTCACCAAGGAGCAG GTGACTAACGAGATCATTCCGATGCTGCCCTACTCCCACCTGGCTGTGCTGGTCCCGGTCTTCCTG

CTCACCGACTACCTGCGATACAAGCCAGTCTTGGTCCTGCAGTGCCTGAGCTTCGTGTGCGTGTGGCTGTTGCTGCTGCTGGGCACATCTGTCGTGCACA

TGCAACTCATGGAAGTCTTCTACAGCGTCACCATGGCGGCCCGCATCGCCTACTCCTCCTACATATTCTCCCTGGTGCACCCCTCCCGCTACCAGCGCAT

GGCCAGCTACTCACGGGCGGCAGTACTGCTGGGAGTCTTCATCAGCTCTGTGTTGGGCCAGGCGCTGGTCACCGTAGGACATATAAGCACCTATACACTC

AACTGTGTCTCCCTGGGCTTCATCCTCTTCAGCCTGGTCCTCTCCCTCTTTCTAAAGCGCCCTAAGCGGAGCCTCTTTTTCAACCGCAGTACGCTTGCGC

GTGGAGCCTTGCCCTGTGAGCTGGATCAGATGCACCCGGGGCCTGACCGGCCAGAAACCAGGAAACTAGATCGCATGCTGGGCACTTGCAGGGACTCCTT

CCTGGTGCGCATGCTAAGTGAACTGGTGGAAAATGCTCGGCAACCACAGCTGCGTCTCTGGTGCCTCTGGTGGGTCTTCAACTCTTCAGGCTACTACCTG

ATCACCTACTATGTGCATGTCCTGTGGAGAAGCACTGACAGCAGCCTCAGCTACAATGGCGCCGTAGATGCCGCCTCCACACTGCTGA GCGCCATCACG

TCCTTCTCCGCCGGCTTCCTGAGCATCCGCTGGACTCTGTGGTCCAAGCTGGTCATCGCAGGTGTGATCGCCATCCAGGCCAGCCTGGTTTTCTGTATGT

TCCAGATCCGGGACATCTGGGTGTGCTACGTGACCTTTGTGCTTTTCCGTGGGGCCTACCAGTTCCTTGTGCCCATTGCCAC GCCTCAC
Translation
 - UNI17465 - MVPTGQVAEKQAYEEPRQDHELKSWRCLVFYLCFFGFMAQLRPGESFITPFLLERKFTKEQ VTNEIIPMLPYSHLAVLVPVFLLT

DYLRYKPVLVLQCLSFVCVWLLLLLGTSVVHMQLMEVFYSVTMAARIAYSSYIFSLVHPSRYQRMASYSRAAVLLGVFISSVLGQALVTVGHISTYTLNC

VSLGFILFSLVLSLFLKRPKRSLFFNRSTLARGALPCELDQMHPGPDRPETRKLDRMLGTCRDSFLVRMLSELVENARQPQLRLWCLWWVFNSSGYYLIT

YYVHVLWRSTDSSLSYNGAVDAASTLLS SAITSFSAGFLSIRWTLWSKLVIAGVIAIQASLVFCMFQIRDIWVCYVTFVLFRGAYQFLVPIAT TPH
Transcript ENSMUST00000105410
Sequence
GTGTGCGCGTTGAATCAGCCACAGGCCTGTGGGACGCAGAGCTAGGAATCCATTCTATGCGTGCCTGGGGAGCCACGGGGTAGTGCAAG - UNI17465

 - GTGGAGTGTCATCTTGGCCCGCCAGTTCCCATGAGGACCTGGGCAACATGGTGCCCACTGGCCAGGTGGCAGAAAAGCAGGCATACGAAGAGCCCAG

GCAGGACCACGAACTGAAATCCTGGCGATGCCTGGTGTTCTATCTCTGCTTCTTCGGCTTCATGGCCCAGTTGCGTCCTGGGGAAAGCTTCATCACACCC

TTCCTCCTGGAACGTAAATTCACCAAGGAGCAG GTGACTAACGAGATCATTCCGATGCTGCCCTACTCCCACCTGGCTGTGCTGGTCCCGGTCTTCCTG

CTCACCGACTACCTGCGATACAAGCCAGTCTTGGTCCTGCAGTGCCTGAGCTTCGTGTGCGTGTGGCTGTTGCTGCTGCTGGGCACATCTGTCGTGCACA

TGCAACTCATGGAAGTCTTCTACAGCGTCACCATGGCGGCCCGCATCGCCTACTCCTCCTACATATTCTCCCTGGTGCACCCCTCCCGCTACCAGCGCAT

GGCCAGCTACTCACGGGCGGCAGTACTGCTGGGAGTCTTCATCAGCTCTGTGTTGGGCCAGGCGCTGGTCACCGTAGGACATATAAGCACCTATACACTC

AACTGTGTCTCCCTGGGCTTCATCCTCTTCAGCCTGGTCCTCTCCCTCTTTCTAAAGCGCCCTAAGCGGAGCCTCTTTTTCAACCGCAGTACGCTTGCGC

GTGGAGCCTTGCCCTGTGAGCTGGATCAGATGCACCCGGGGCCTGACCGGCCAGAAACCAGGAAACTAGATCGCATGCTGGGCACTTGCAGGGACTCCTT

CCTGGTGCGCATGCTAAGTGAACTGGTGGAAAATGCTCGGCAACCACAGCTGCGTCTCTGGTGCCTCTGGTGGGTCTTCAACTCTTCAGGCTACTACCTG

ATCACCTACTATGTGCATGTCCTGTGGAGAAGCACTGACAGCAGCCTCAGCTACAATGGCGCCGTAGATGCCGCCTCCACACTGCTGA GCGCCATCACG

TCCTTCTCCGCCGGCTTCCTGAGCATCCGCTGGACTCTGTGGTCCAAGCTGGTCATCGCAGGTGTGATCGCCATCCAGGCCAGCCTGGTTTTCTGTATGT

TCCAGATCCGGGACATCTGGGTGTGCTACGTGACCTTTGTGCTTTTCCGTGGGGCCTACCAGTTCCTTGTGCCCATTGCCAC TTTTCAGATTGCGTCTT

CCCTGTCTAAAGAGCTCTGTGCATTGGTCTTTGGGATCAACACTTTCCTAGCTACTGCGCTTAAGACCTGTATCACACTTGTGGTCTCTGACAAGCGGGG

TCTGGGTCTCCAAGTCCGTGATCAG TTCCGTATCTACTTCATATACTTCCTGATGCTGTCTATCACCTGCTTTGCCTGGGCGGGGCTGGATGGCTTAAG

GTACTGCCAGCGTGGTCGCCACCAGCCCCTGGCCCAGGCCCAGGAGCTGAGGAGTCCCTTGGAGACTTCTGTGCAAGCGATAAGCCTACAGGATGGAGAC

CTAAGGGGACCGCAGCCCTCAGCGCCACAGCTGCTCTCAGAGGATGGCATGGAGGACGACAGGGGAGACTTAAGAGTCGAAGCCAAGGCTTGACCTTCCT

AGCTTCATCCCAGTTCAGCGGCGGGATTCCTGACTCAGAGGCAGCCCCTCCTGTTTGCACTCCACCTGAACCAGCCTGGGCCTGATGCTACACACAGTGC

TCCCAGTCGATGTTGCCTTGAGTCCAAGACATACAGGGGGCCCCCGCTGTTGCCTTTTAGGAGCCTTTAGGTTAGGCCACAGAACCCTCCTTAAGGGGCC

ACCTGTTAGCTTATCCTTCTGAGGACCCTAAACCCAGCCTACTTCATGCTTTAGCAATGGCTGTAGCCTGCTACCGACACTCAAGGGCAGCTCCCTGGCT

TTGTGAACCACGTGCCAGGCCACTGCGAGTCTGGGTTGTCTATTGCTTGCCAAGAAGAACCTGTGTCGGGCTCAACTATGCCCACCAGGCCATTCTGCCT

TTTTTGCTCTGGGAAGCTCTGGGCAAATCATGTCTGCCCCTTAGGGCTAGTGAGGTAGCCCAGATGCCAGCCAAGGTCCGCTGAGCCTGCAGGGTGCCAG

TTGCCTGCCCTAGGCTCCTGGCTATGCTGCCATACATCCTTCCACTATCGGAGGTGCTTGTTTAAATGGTTTTCTGATTTCTTTTTTAACTTGACATTAA

AATGGAGAACTAC
Translation
 - UNI17465 - MVPTGQVAEKQAYEEPRQDHELKSWRCLVFYLCFFGFMAQLRPGESFITPFLLERKFTKEQ VTNEIIPMLPYSHLAVLVPVFLLT

DYLRYKPVLVLQCLSFVCVWLLLLLGTSVVHMQLMEVFYSVTMAARIAYSSYIFSLVHPSRYQRMASYSRAAVLLGVFISSVLGQALVTVGHISTYTLNC

VSLGFILFSLVLSLFLKRPKRSLFFNRSTLARGALPCELDQMHPGPDRPETRKLDRMLGTCRDSFLVRMLSELVENARQPQLRLWCLWWVFNSSGYYLIT

YYVHVLWRSTDSSLSYNGAVDAASTLLS SAITSFSAGFLSIRWTLWSKLVIAGVIAIQASLVFCMFQIRDIWVCYVTFVLFRGAYQFLVPIAT TFQIA

SSLSKELCALVFGINTFLATALKTCITLVVSDKRGLGLQVRDQ FRIYFIYFLMLSITCFAWAGLDGLRYCQRGRHQPLAQAQELRSPLETSVQAISLQD

GDLRGPQPSAPQLLSEDGMEDDRGDLRVEAKA

For any suggestions or comments, please send an email to unitrap@crg.es