Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001472 (Tcf25)
Chromosomal location
Chr 8: 125897649 - 125927706 (+)
Description
transcription factor 25 (basic helix-loop-helix) Gene [Source:MGI Symbol;Acc:MGI:1914105]
RefSeq_dna
NM_001037878 
RefSeq_peptide
NP_080080.2 NP_001032967.1 NP_001032966.1 
UniGene
Mm.399528 
MGI
MGI:1914105 
Uniprot/SWISSPROT
Q8R3L2 
Uniprot/SPTREMBL
Q80TL2 B2ZAC8 
Human Ortholog
ENSG00000141002 (TCF25)
Omim not available
UniTrap UNI8274
Vector Insertion
Chr 8: 125897965 - 125905299
Public Clones RRF156 (baygenomics) RRE309 (baygenomics)
Private Clones OST461924 (lexicon) OST437356 (lexicon) OST111642 (lexicon) OST111595 (lexicon)
OST66122 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26542
Vector Insertion
Chr 8: 125905462 - 125906426
Public Clones not available
Private Clones OST111738 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18822
Vector Insertion
Chr 8: 125913696 - 125914678
Public Clones not available
Private Clones OST413589 (lexicon)
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18358
Vector Insertion
Chr 8: 125922507 - 125923164
Public Clones not available
Private Clones OST424991 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108840
Sequence
TTCCGGAGAGCCGCGGCGCGCAAACGCGACACGCCAATCTTGCGCCAGCGCGCCGCAAGTGCGCAGGCGCCGCCACACTGCTGCTCTTCCTCGTCCCTCT

GCCCACATCAGGCTGTCGGGTCCTATGTCGCGCCGGGCCCTCCGGAGACTGAGGGGGGAACAGCGCGGCCAGGAACCCCTAGGGCCCGACGCCTTGAAGT

TTGTCCTCCTTGATGACGATGACGCAGAGGAAGAGGGACCAAAACCGGGGCTGGGTGGCCGGCGCCCCGGGGGTGCAGGGAAGGAAGGAGTCCGTGTCAA

CAACCGGTTTGAGCTG - UNI8274 - ATAAACACGGAGGATCTTGAGGATGACCTTGTGGTAAATGGGGAGAGATCTGACTGTACCCTGCCGGACTC

TGTGTCATCAGGGAACAAAGGAAGGGCTAAACATGGAAACGCAGAGACCAAGCAAGATGGAGGGGCCACCAAAGCAGGGTCCTCGGAACAG - UNI265

42 - TCTAATGCAAGTGGCAAACTCCGAAAGAAGAAAAAGAAGCAGAAAAATAAGAAAAGCTGCACAGGAGAATCCTCG GAGAATGGACTAGAAGACA

TCGATCGCATCTTAGAGCGGATTGAGGACAGCAGTGGGTTCAGCCACCCCGGCCCCCCTCCACTGAGCTCCAGGAAGCACGTCCTATATGTGGAGCACAG

 ACACCTGAATCCAGACACGGAACTGAAGAGGTATTTTGGTGCTCGAGCGGTCCTGGGCGAGCAAAG GCCTCGACAGAGGCAGCGTGTGTATCCCAAGT

GTACATGGCTGACGACCCCTAAGAGCACCTGGCCCCGGTACAGCAAACCAG GTCTATCAATGCGGCTGCTGGAGTCCAAGAAAGGCCTTTCTTTCTTTG

CATTTGACCATAATGAAGAATACCAACAAGCACAGCACAAGTTCCTGGTGGCTGTGGAGTCCATGGAGCCAAATAACATTGTG - UNI18822 - GTT

CTGCTCCAGACAAGCCCCTATCATGTGGACTCCCTGCTGCAGCTCAGTGATGCCTGCCGCTTTCAAGAGGATCAAGAGATGGCTCGAGACCTTATAG AG

AGAGCCCTGTACAGCATGGAGTGTGCATTCCACCCCTTGTTCAGTCTCACCAGTGGAACTTGCAGGCTGGATTATCGCAGACCTGAGAATAG GAGCTTC

TACCTGACCCTCTACAAGCAGATGAGTTTCTTGGAGAAACGTGGATGCCCACGTACTGCGCTGGAGTACTGCAAGCTCATCCTGAG CCTTGAGCCAGAT

GAGGACCCCCTGTGCATGTTGCTGCTTATTGACCACCTGGCCTTACGGGCCCGGAACTATGAATACCTGATTCGCCTCTTCCAGGAATGGGAG GCTCAT

CGGAACCTGTCCCAGCTCCCAAATTTTGCCTTCTCAGTTCCACTGGCCTATTTCCTTCTGAGTCAGCAAACAGACTTACCTGAGCATGAGCTCAGCTCTG

CCAGGCAACAGGCTTCCCTCCTGATACAGCAGGCACTCACCATGTTCCCTGGAG TTCTTATGCCACTGCTGGAGTATTGCAGTGTGCGACCTGATGCCA

CGGTCTCAAACCACCGCTTCTTTGGGCCGGATGCTGAGATCAG CCAGCCTCCCGCCTTGGGCCAGCTGGTGAGTCTGTACCTGGGGAGGTCACACTTTC

TTTGGAAAGAACCCGCCATTATGAGCTGGCTAGAGGAAAATGTCCATGAGGTTCTGCAAGCGGTGGATGCTGGAGACCCTGCTGTGGAGGCCTGTGAGAA

CAG GCGGAAAGTGTTGTACCAGCGTGCGCCCAGAAACATCCACCGCCACGTGATACTGTCTGAGATCAAGGAGGCTGTTGCTGCCCTACCCTCG - UN

I18358 - GATGTGACCACACAGTCTGTGATGGGGTTCGACCCTCTGCCTCCCCTGGACACCATCTACTCTTACGTCAGACCAGAGAG GCTGAGTCCA

GTCAGCCACGGAAACACAATCGCCCTCTTCTTCCGGTCCTTGTTGCCAAATTACACCACAGAG CTGTAAGTCCATCCGGATGAGGATGTGACATCTGGA

GCTGCAGCAGCTATTCTGCAACCACGTGACAACGAATTCCAAAATGAAGAGCCATGCTCTAGGAACAGTGAAGCAGAGGATACCCCAGGCCTTCAGGAAC

GTCCCACCTGCAGGCCTGTTTCCTGAGAGGCCATCAGATGATCGGCTTCAGAAGTGTTGCTCAGCCTTGCAACTGAATTCATTTCTAATGGTGAAAAATA

AAACCAGTCCTTCACACCACCTGTGGATCATCATCGGGAAAAGTAACTTTCTGAGACAGAGTCTCACTGTGTAGCCCGTAGTGGCCTGGAGCTTGCTATG

TAGACCAGGCCGCCCTTTACTCTGTAGACCAGGCTGGCCTCGGAGATCCGCCTGCCTCTGTCTCCCAAATGTTAGGATTAAAAGAGTGCACCACCACACC

TAACCTGCATGTCATCTCAACAGCTTTAAAGTCTGGCCTGTCACCCAGGTAGGGGTGACAGTGTGTCCCGCTCCTCCCGTACCTCCCTGGCCCCTTTCCC

AAGAGGCGCCTGCCTATGTGTTCTGTGCAGAATTGTTGGTCATTTGTGCATTTTCATGTAGTCAGGGAGAAAACCTGTTTGCTGCCTCTCAGAGAAAGTT

CACAAGAAATGAAAGACTTTG
Translation
SGEPRRANATRQSCASAPQVRRRRHTAALPRPSAHIRLSGPMSRRALRRLRGEQRGQEPLGPDALKFVLLDDDDAEEEGPKPGLGGRRPGGAGKEGVRVN

NRFEL - UNI8274 - INTEDLEDDLVVNGERSDCTLPDSVSSGNKGRAKHGNAETKQDGGATKAGSSEQ - UNI26542 - SNASGKLRKKKKKQ

KNKKSCTGESS ENGLEDIDRILERIEDSSGFSHPGPPPLSSRKHVLYVEHR RHLNPDTELKRYFGARAVLGEQR RPRQRQRVYPKCTWLTTPKSTWP

RYSKPG GLSMRLLESKKGLSFFAFDHNEEYQQAQHKFLVAVESMEPNNIV - UNI18822 - VLLQTSPYHVDSLLQLSDACRFQEDQEMARDLIE 

ERALYSMECAFHPLFSLTSGTCRLDYRRPENR RSFYLTLYKQMSFLEKRGCPRTALEYCKLILS SLEPDEDPLCMLLLIDHLALRARNYEYLIRLFQE

WE AHRNLSQLPNFAFSVPLAYFLLSQQTDLPEHELSSARQQASLLIQQALTMFPGV VLMPLLEYCSVRPDATVSNHRFFGPDAEIS SQPPALGQLVS

LYLGRSHFLWKEPAIMSWLEENVHEVLQAVDAGDPAVEACENR RRKVLYQRAPRNIHRHVILSEIKEAVAALPS - UNI18358 - DVTTQSVMGFD

PLPPLDTIYSYVRPER RLSPVSHGNTIALFFRSLLPNYTTE L
Transcript ENSMUST00000057934
Sequence
GCTCTTCCTCGTCCCTCTGCCCACATCAGGCTGTCGGGTCCTATGTCGCGCCGGGCCCTCCGGAGACTGAGGGGGGAACAGCGCGGCCAGGAACCCCTAG

GGCCCGACGCCTTGAAGTTTGTCCTCCTTGATGACGATGACGCAGAGGAAGAGGGACCAAAACCGGGGCTGGGTGGCCGGCGCCCCGGGGGTGCAGGGAA

GGAAGGAGTCCGTGTCAACAACCGGTTTGAGCTG - UNI8274 - ATAAACACGGAGGATCTTGAGGATGACCTTGTGGTAAATGGGGAGAGATCTGA

CTGTACCCTGCCGGACTCTGTGTCATCAGGGAACAAAGGAAGGGCTAAACATGGAAACGCAGAGACCAAGCAAGATGGAGGGGCCACCAAAGCAGGGTCC

TCGGAACAG - UNI26542 - TCTAATGCAAGTGGCAAACTCCGAAAGAAGAAAAAGAAGCAGAAAAATAAGAAAAGCTGCACAGGAGAATCCTCG G

AGAATGGACTAGAAGACATCGATCGCATCTTAGAGCGGATTGAGGACAGCAGTGGGTTCAGCCACCCCGGCCCCCCTCCACTGAGCTCCAGGAAGCACGT

CCTATATGTGGAGCACAG ACACCTGAATCCAGACACGGAACTGAAGAGGTATTTTGGTGCTCGAGCGGTCCTGGGCGAGCAAAG GCCTCGACAGAGGC

AGCGTGTGTATCCCAAGTGTACATGGCTGACGACCCCTAAGAGCACCTGGCCCCGGTACAGCAAACCAG GTCTATCAATGCGGCTGCTGGAGTCCAAGA

AAGGCCTTTCTTTCTTTGCATTTGACCATAATGAAGAATACCAACAAGCACAGCACAAGTTCCTGGTGGCTGTGGAGTCCATGGAGCCAAATAACATTGT

G - UNI18822 - GTTCTGCTCCAGACAAGCCCCTATCATGTGGACTCCCTGCTGCAGCTCAGTGATGCCTGCCGCTTTCAAGAGGATCAAGAGATGG

CTCGAGACCTTATAG AGAGAGCCCTGTACAGCATGGAGTGTGCATTCCACCCCTTGTTCAGTCTCACCAGTGGAACTTGCAGGCTGGATTATCGCAGAC

CTGAGAATAG GAGCTTCTACCTGACCCTCTACAAGCAGATGAGTTTCTTGGAGAAACGTGGATGCCCACGTACTGCGCTGGAGTACTGCAAGCTCATCC

TGAG CCTTGAGCCAGATGAGGACCCCCTGTGCATGTTGCTGCTTATTGACCACCTGGCCTTACGGGCCCGGAACTATGAATACCTGATTCGCCTCTTCC

AGGAATGGGAG GCTCATCGGAACCTGTCCCAGCTCCCAAATTTTGCCTTCTCAGTTCCACTGGCCTATTTCCTTCTGAGTCAGCAAACAGACTTACCTG

AGCATGAGCTCAGCTCTGCCAGGCAACAGGCTTCCCTCCTGATACAGCAGGCACTCACCATGTTCCCTGGAG TTCTTATGCCACTGCTGGAGTATTGCA

GTGTGCGACCTGATGCCACGGTCTCAAACCACCGCTTCTTTGGGCCGGATGCTGAGATCAG CCAGCCTCCCGCCTTGGGCCAGCTGGTGAGTCTGTACC

TGGGGAGGTCACACTTTCTTTGGAAAGAACCCGCCATTATGAGCTGGCTAGAGGAAAATGTCCATGAGGTTCTGCAAGCGGTGGATGCTGGAGACCCTGC

TGTGGAGGCCTGTGAGAACAG GCGGAAAGTGTTGTACCAGCGTGCGCCCAGAAACATCCACCGCCACGTGATACTGTCTGAGATCAAGGAGGCTGTTGC

TGCCCTACCCTCG - UNI18358 - GATGTGACCACACAGTCTGTGATGGGGTTCGACCCTCTGCCTCCCCTGGACACCATCTACTCTTACGTCAGAC

CAGAGAG GCTGAGTCCAGTCAGCCACGGAAACACAATCGCCCTCTTCTTCCGGTCCTTGTTGCCAAATTACACCACAGAG GGGGAGAGGCTGGAGGAA

GGAGTGGCCGGGGGTCCGAACCGCAATCAAGGCTTGAACAGGCTGATGTTGGCCGTACGTGACATGATGGCCAACTTCCACTTCAACGACCTGGAGGTGC

CTCGGGAGGACAATCCTGAGGGCGAGGGGGACTGGGACTGAACTGTCCAGATGCTGTGCCCAGAGCCGTGCAGTCACGTTCCCGAATTCATTTCTGGTTG

GAGTTAACCAGTTCCGAGTAGAAATGCTGACCATGCC
Translation
MSRRALRRLRGEQRGQEPLGPDALKFVLLDDDDAEEEGPKPGLGGRRPGGAGKEGVRVNNRFEL - UNI8274 - INTEDLEDDLVVNGERSDCTLPD

SVSSGNKGRAKHGNAETKQDGGATKAGSSEQ - UNI26542 - SNASGKLRKKKKKQKNKKSCTGESS ENGLEDIDRILERIEDSSGFSHPGPPPLS

SRKHVLYVEHR RHLNPDTELKRYFGARAVLGEQR RPRQRQRVYPKCTWLTTPKSTWPRYSKPG GLSMRLLESKKGLSFFAFDHNEEYQQAQHKFLVA

VESMEPNNIV - UNI18822 - VLLQTSPYHVDSLLQLSDACRFQEDQEMARDLIE ERALYSMECAFHPLFSLTSGTCRLDYRRPENR RSFYLTLY

KQMSFLEKRGCPRTALEYCKLILS SLEPDEDPLCMLLLIDHLALRARNYEYLIRLFQEWE AHRNLSQLPNFAFSVPLAYFLLSQQTDLPEHELSSARQ

QASLLIQQALTMFPGV VLMPLLEYCSVRPDATVSNHRFFGPDAEIS SQPPALGQLVSLYLGRSHFLWKEPAIMSWLEENVHEVLQAVDAGDPAVEACE

NR RRKVLYQRAPRNIHRHVILSEIKEAVAALPS - UNI18358 - DVTTQSVMGFDPLPPLDTIYSYVRPER RLSPVSHGNTIALFFRSLLPNYTT

E GERLEEGVAGGPNRNQGLNRLMLAVRDMMANFHFNDLEVPREDNPEGEGDWD
Transcript ENSMUST00000108839
Sequence
GCTCTTCCTCGTCCCTCTGCCCACATCAGGCTGTCGGGTCCTATGTCGCGCCGGGCCCTCCGGAGACTGAGGGGGGAACAGCGCGGCCAGGAACCCCTAG

GGCCCGACGCCTTGAAGTTTGTCCTCCTTGATGACGATGACGCAGAGGAAGAGGGACCAAAACCGGGGCTGGGTGGCCGGCGCCCCGGGGGTGCAGGGAA

GGAAGGAGTCCGTGTCAACAACCGGTTTGAGCTG - UNI8274 - ATAAACACGGAGGATCTTGAGGATGACCTTGTGGTAAATGGGGAGAGATCTGA

CTGTACCCTGCCGGACTCTGTGTCATCAGGGAACAAAGGAAGGGCTAAACATGGAAACGCAGAGACCAAGCAAGATGGAGGGGCCACCAAAGCAGGGTCC

TCGGAACAG - UNI26542 - GAGAATGGACTAGAAGACATCGATCGCATCTTAGAGCGGATTGAGGACAGCAGTGGGTTCAGCCACCCCGGCCCCCC

TCCACTGAGCTCCAGGAAGCACGTCCTATATGTGGAGCACAG ACACCTGAATCCAGACACGGAACTGAAGAGGTATTTTGGTGCTCGAGCGGTCCTGGG

CGAGCAAAG GCCTCGACAGAGGCAGCGTGTGTATCCCAAGTGTACATGGCTGACGACCCCTAAGAGCACCTGGCCCCGGTACAGCAAACCAG GTCTAT

CAATGCGGCTGCTGGAGTCCAAGAAAGGCCTTTCTTTCTTTGCATTTGACCATAATGAAGAATACCAACAAGCACAGCACAAGTTCCTGGTGGCTGTGGA

GTCCATGGAGCCAAATAACATTGTG - UNI18822 - GTTCTGCTCCAGACAAGCCCCTATCATGTGGACTCCCTGCTGCAGCTCAGTGATGCCTGCC

GCTTTCAAGAGGATCAAGAGATGGCTCGAGACCTTATAG AGAGAGCCCTGTACAGCATGGAGTGTGCATTCCACCCCTTGTTCAGTCTCACCAGTGGAA

CTTGCAGGCTGGATTATCGCAGACCTGAGAATAG GAGCTTCTACCTGACCCTCTACAAGCAGATGAGTTTCTTGGAGAAACGTGGATGCCCACGTACTG

CGCTGGAGTACTGCAAGCTCATCCTGAG CCTTGAGCCAGATGAGGACCCCCTGTGCATGTTGCTGCTTATTGACCACCTGGCCTTACGGGCCCGGAACT

ATGAATACCTGATTCGCCTCTTCCAGGAATGGGAG GCTCATCGGAACCTGTCCCAGCTCCCAAATTTTGCCTTCTCAGTTCCACTGGCCTATTTCCTTC

TGAGTCAGCAAACAGACTTACCTGAGCATGAGCTCAGCTCTGCCAGGCAACAGGCTTCCCTCCTGATACAGCAGGCACTCACCATGTTCCCTGGAG TTC

TTATGCCACTGCTGGAGTATTGCAGTGTGCGACCTGATGCCACGGTCTCAAACCACCGCTTCTTTGGGCCGGATGCTGAGATCAG CCAGCCTCCCGCCT

TGGGCCAGCTGGTGAGTCTGTACCTGGGGAGGTCACACTTTCTTTGGAAAGAACCCGCCATTATGAGCTGGCTAGAGGAAAATGTCCATGAGGTTCTGCA

AGCGGTGGATGCTGGAGACCCTGCTGTGGAGGCCTGTGAGAACAG GCGGAAAGTGTTGTACCAGCGTGCGCCCAGAAACATCCACCGCCACGTGATACT

GTCTGAGATCAAGGAGGCTGTTGCTGCCCTACCCTCG - UNI18358 - GATGTGACCACACAGTCTGTGATGGGGTTCGACCCTCTGCCTCCCCTGG

ACACCATCTACTCTTACGTCAGACCAGAGAG GCTGAGTCCAGTCAGCCACGGAAACACAATCGCCCTCTTCTTCCGGTCCTTGTTGCCAAATTACACCA

CAGAG GGGGAGAGGCTGGAGGAAGGAGTGGCCGGGGGTCCGAACCGCAATCAAGGCTTGAACAGGCTGATGTTGGCCGTACGTGACATGATGGCCAACT

TCCACTTCAACGACCTGGAGGTGCCTCGGGAGGACAATCCTGAGGGCGAGGGGGACTGGGACTGAACTGTCCAGATGCTGTGCCCAGAGCCGTGCAGTCA

CGTTCCCGAATTCATTTCTGGTTGGAGTTAACCAGTTCCGAGTAGAAATGCTGACCATGCC
Translation
MSRRALRRLRGEQRGQEPLGPDALKFVLLDDDDAEEEGPKPGLGGRRPGGAGKEGVRVNNRFEL - UNI8274 - INTEDLEDDLVVNGERSDCTLPD

SVSSGNKGRAKHGNAETKQDGGATKAGSSEQ - UNI26542 - ENGLEDIDRILERIEDSSGFSHPGPPPLSSRKHVLYVEHR RHLNPDTELKRYFG

ARAVLGEQR RPRQRQRVYPKCTWLTTPKSTWPRYSKPG GLSMRLLESKKGLSFFAFDHNEEYQQAQHKFLVAVESMEPNNIV - UNI18822 - VL

LQTSPYHVDSLLQLSDACRFQEDQEMARDLIE ERALYSMECAFHPLFSLTSGTCRLDYRRPENR RSFYLTLYKQMSFLEKRGCPRTALEYCKLILS S

LEPDEDPLCMLLLIDHLALRARNYEYLIRLFQEWE AHRNLSQLPNFAFSVPLAYFLLSQQTDLPEHELSSARQQASLLIQQALTMFPGV VLMPLLEYC

SVRPDATVSNHRFFGPDAEIS SQPPALGQLVSLYLGRSHFLWKEPAIMSWLEENVHEVLQAVDAGDPAVEACENR RRKVLYQRAPRNIHRHVILSEIK

EAVAALPS - UNI18358 - DVTTQSVMGFDPLPPLDTIYSYVRPER RLSPVSHGNTIALFFRSLLPNYTTE GERLEEGVAGGPNRNQGLNRLMLA

VRDMMANFHFNDLEVPREDNPEGEGDWD
Transcript ENSMUST00000093050
Sequence
GCTCTTCCTCGTCCCTCTGCCCACATCAGGCTGTCGGGTCCTATGTCGCGCCGGGCCCTCCGGAGACTGAGGGGGGAACAGCGCGGCCAGGAACCCCTAG

GGCCCGACGCCTTGAAGTTTGTCCTCCTTGATGACGATGACGCAGAGGAAGAGGGACCAAAACCGGGGCTGGGTGGCCGGCGCCCCGGGGGTGCAGGGAA

GGAAGGAGTCCGTGTCAACAACCGGTTTGAGCTG - UNI8274 - ATAAACACGGAGGATCTTGAGGATGACCTTGTGGTAAATGGGGAGAGATCTGA

CTGTACCCTGCCGGACTCTGTGTCATCAGGGAACAAAGGAAGGGCTAAACATGGAAACGCAGAGACCAAGCAAGATGGAGGGGCCACCAAAGCAGGGTCC

TCGGAACAG - UNI26542 - TCTAATGCAAGTGGCAAACTCCGAAAGAAGAAAAAGAAGCAGAAAAATAAGAAAAGCTGCACAGGAGAATCCTCG G

AGAATGGACTAGAAGACATCGATCGCATCTTAGAGCGGATTGAGGACAGCAGTGGGTTCAGCCACCCCGGCCCCCCTCCACTGAGCTCCAGGAAGCACGT

CCTATATGTGGAGCACAG ACACCTGAATCCAGACACGGAACTGAAGAGGTATTTTGGTGCTCGAGCGGTCCTGGGCGAGCAAAG GCCTCGACAGAGGC

AGCGTGTGTATCCCAAGTGTACATGGCTGACGACCCCTAAGAGCACCTGGCCCCGGTACAGCAAACCAG GTCTATCAATGCGGCTGCTGGAGTCCAAGA

AAGGCCTTTCTTTCTTTGCATTTGACCATAATGAAGAATACCAACAAGCACAGCACAAGTTCCTGGTGGCTGTGGAGTCCATGGAGCCAAATAACATTGT

G - UNI18822 - GTTCTGCTCCAGACAAGCCCCTATCATGTGGACTCCCTGCTGCAGCTCAGTGATGCCTGCCGCTTTCAAGAGGATCAAGAGATGG

CTCGAGACCTTATAG AGAGAGCCCTGTACAGCATGGAGTGTGCATTCCACCCCTTGTTCAGTCTCACCAGTGGAACTTGCAGGCTGGATTATCGCAGAC

CTGAGAATAG GAGCTTCTACCTGACCCTCTACAAGCAGATGAGTTTCTTGGAGAAACGTGGATGCCCACGTACTGCGCTGGAGTACTGCAAGCTCATCC

TGAG CCTTGAGCCAGATGAGGACCCCCTGTGCATGTTGCTGCTTATTGACCACCTGGCCTTACGGGCCCGGAACTATGAATACCTGATTCGCCTCTTCC

AGGAATGGGAG GCTCATCGGAACCTGTCCCAGCTCCCAAATTTTGCCTTCTCAGTTCCACTGGCCTATTTCCTTCTGAGTCAGCAAACAGACTTACCTG

AGCATGAGCTCAGCTCTGCCAGGCAACAGGCTTCCCTCCTGATACAGCAGGCACTCACCATGTTCCCTGGAG TTCTTATGCCACTGCTGGAGTATTGCA

GTGTGCGACCTGATGCCACGGTCTCAAACCACCGCTTCTTTGGGCCGGATGCTGAGATCAG CCAGCCTCCCGCCTTGGGCCAGCTGGTGAGTCTGTACC

TGGGGAGGTCACACTTTCTTTGGAAAGAACCCGCCATTATGAGCTGGCTAGAGGAAAATGTCCATGAGGTTCTGCAAGCGGTGGATGCTGGAGACCCTGC

TGTGGAGGCCTGTGAGAACAG GCGGAAAGTGTTGTACCAGCGTGCGCCCAGAAACATCCACCGCCACGTGATACTGTCTGAGATCAAGGAGGCTGTTGC

TGCCCTACCCTCG - UNI18358 - GATGTGACCACACAGTCTGTGATGGGGTTCGACCCTCTGCCTCCCCTGGACACCATCTACTCTTACGTCAGAC

CAGAGAG GCTGAGTCCAGTCAGCCACGGAAACACAATCGCCCTCTTCTTCCGGTCCTTGTTGCCAAATTACACCACAGAG CAGCTG
Translation
MSRRALRRLRGEQRGQEPLGPDALKFVLLDDDDAEEEGPKPGLGGRRPGGAGKEGVRVNNRFEL - UNI8274 - INTEDLEDDLVVNGERSDCTLPD

SVSSGNKGRAKHGNAETKQDGGATKAGSSEQ - UNI26542 - SNASGKLRKKKKKQKNKKSCTGESS ENGLEDIDRILERIEDSSGFSHPGPPPLS

SRKHVLYVEHR RHLNPDTELKRYFGARAVLGEQR RPRQRQRVYPKCTWLTTPKSTWPRYSKPG GLSMRLLESKKGLSFFAFDHNEEYQQAQHKFLVA

VESMEPNNIV - UNI18822 - VLLQTSPYHVDSLLQLSDACRFQEDQEMARDLIE ERALYSMECAFHPLFSLTSGTCRLDYRRPENR RSFYLTLY

KQMSFLEKRGCPRTALEYCKLILS SLEPDEDPLCMLLLIDHLALRARNYEYLIRLFQEWE AHRNLSQLPNFAFSVPLAYFLLSQQTDLPEHELSSARQ

QASLLIQQALTMFPGV VLMPLLEYCSVRPDATVSNHRFFGPDAEIS SQPPALGQLVSLYLGRSHFLWKEPAIMSWLEENVHEVLQAVDAGDPAVEACE

NR RRKVLYQRAPRNIHRHVILSEIKEAVAALPS - UNI18358 - DVTTQSVMGFDPLPPLDTIYSYVRPER RLSPVSHGNTIALFFRSLLPNYTT

E QL

For any suggestions or comments, please send an email to unitrap@crg.es