Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001482 (Def8)
Chromosomal location
Chr 8: 125966886 - 125987170 (+)
Description
differentially expressed in FDCP 8 Gene [Source:MGI (curated);Acc:Def8-003]
RefSeq_dna
NM_054046 
RefSeq_peptide
NP_473387.1 
UniGene
Mm.457304 Mm.275127 
MGI
MGI:1346331 
Uniprot/SWISSPROT
Q99J78 
Human Ortholog
ENSG00000140995 (DEF8)
Omim not available
UniTrap UNI30264
Vector Insertion
Chr 8: 125970085 - 125971216
Public Clones D053C08 (ggtc) IST14540C6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30101
Vector Insertion
Chr 8: 125971264 - 125971687
Public Clones D117E12 (ggtc) D117F12 (ggtc) IST14503C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20090
Vector Insertion
Chr 8: 125971687 - 125971813
Public Clones not available
Private Clones OST373173 (lexicon) OST303303 (lexicon) OST297769 (lexicon) OST297403 (lexicon)
OST207829 (lexicon) OST130081 (lexicon) OST104542 (lexicon) OST75945 (lexicon)
OST69001 (lexicon) OST51474 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34300
Vector Insertion
Chr 8: 125971813 - 125973200
Public Clones IST14957F8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21332
Vector Insertion
Chr 8: 125973299 - 125976644
Public Clones not available
Private Clones OST334124 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28478
Vector Insertion
Chr 8: 125976795 - 125978128
Public Clones not available
Private Clones OST30076 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26019
Vector Insertion
Chr 8: 125979479 - 125980305
Public Clones not available
Private Clones OST145455 (lexicon)
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7857
Vector Insertion
Chr 8: 125982332 - 125983416
Public Clones RRP186 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108833
Sequence
ATGCCCTCCTCATGCAGGGTGAAAGG - UNI20090 - - UNI30101 - - UNI30264 - GTGGGATGCTATGGAATATGATGAGAAGCTGGTT

CGGTTCCGGCAGGCCCACCTCAACCCCTTCAACAAGCAGCTTGGTCCGAGGCATCATGAACAGGAACCCAGTGAGAAGGTCACTTCTGAAG - UNI200

90 - ACACTTTGCCTGAGCTGCCCGCTGGGGAGCCTGAATTCCACTACTCGGAGCGCATGATGGATCTCGGCCTGTCTGAGGACCACTTTTCCCGCCCT

GTG - UNI21332 - GGTCTCTTCCTGGCCTCTGATGTCCAGCAGCTGCGGCAGGCCATCGAAGAATGCAAACAGGTGATCCTGGAGCTGCCCGAGCA

GTCAGAGAAGCAGAAGGACGCTGTGGTGCGGCTGATCCACCTCCGGCTGAAGCTCCAGGAGCTGAAG - UNI28478 - GACCCCAATGAGGAGGAAC

CCAACATCCGGGTTCTCCTGGAACATCGCTTCTACAAGGAGAAGAGCAAGAGCGTTAAACAGACCTGCGATAAGTGCAACACCATCATCTGGGGGCTCAT

CCAGACCTGGTACACCTGCACAG GGTGTTGTTACCGCTGTCACAGCAAGTGCCTGAACCTCATCTCCAAACCATGTGTCAGCTCCAAGGTCAGTCACCA

GGCTGAGTATGAGCTGAACATCTGCCCTGAGACCGGGCTGGACAGCCAGGACTACCGCTGTGCGGAGTGCCGTGCTCCCATCTCTCTGA - UNI26019

 - GAGGTGTGCCTAGTGAGGCCCGGCAGTGTGACTACACGGGCCAATACTACTGCAGCCACTGCCACTGGAACGACCTGGCTGTCATCCCCGCGAGAGT

GGTGCACAACTGGGACTTTGAGCCACGCAAG GTGTCCCGTTGCAGCATGCGCTACCTGGCACTGATGGTGTCTCGGCCAGTGCTCCGGCTCCGGGAGAT

TAACCCTTTGCTGTTTAACTACGTGGAAGAGCTGGTGGAGATCCGG AAACTGCGCCAGGACATCCTGCTCATGAAGCCATACTTCATCACCTGCAAGGA

GGCCATGGAGGCGCGACTACTGCTGCAG - UNI7857 - CTCCAAGACAGACAGCATTTTGTGGAGAACGATGAGATGTACTCTATCCAGGACCTCTT

GGAAGTGCACATGGGCCGCCTCAGCTGCTCGCTCACTGAGATCCACACGCTCTTCGCCAAGCACATCAAGTTGGACTGTGAG CGGTGCCAAGCCAAGGG

GTTCGTCTGTGAACTCTGCAAAGAAGGGGACGTGCTCTTCCCGTTCGACAGCCACACGTCTGTGTGCAATGACTGTTCGGCTGTCTTCCACAG GGACTG

TTACTACGACAACTCGACCACGTGCCCCAAGTGTGCCCGGCTCACATTGAGGAAGCAGTCACTATTCCAGGAACCTGGCCTAGACATGGATGCCTAGAAC

ACTGGAGAACGCCAGGCACCGTATCCACCCCTCCGGCTGGTGCCTGCTGGCCTTGCCCACCAGATGTGCATTCTACTCTGGAGACGACCCCCCCCCCCCC

AGTATATCCTCCAGACCTCTTCGTCTCGGGCCAGAAGGAAGTGACTAGTGGCCACCGGGACTCATTCCTCAGGTGCTTGTGGAGACTTCGAGTGTGTATA

CCTGGCTGTTGATTGGGTGTGCTGCTATCGGGGGGTCAAAATACTGCCTGTGCCCCATTGTAGGACTCCTTAGGCAGAGGAGCCTGGGTGTGACTCTCCA

GGAAGGTGGGGGAGTCGCTCTCTTATGGCACAGAGCCCTCCAGGCCTTTAAAACCAATCCTTCTGCACCATAGAGATGGCCTTGCTCCTGTCTAGTACAC

CCTTACAACTGGTCAGAAACTTGAGAGGCCAGTCCAGTAAGACCAGAGGATGCCTCCTGACTGAGTTTTATCTCTGCTGAGGAAGATTTAGGTTCTACTC

AGAGGCACCCAACCCTTTTAGCACCTTGTCTCCTGAGGGACGTCCGGTTTTCTCTGACTGGGGCTGTTCACTACTGTGTCCCGTGGATCTTCCCCTGCAT

CCTGAGAGTTGTCATCGTCATCCTTAATCTGTCAGTCACGTGTGCTTCCCCACCCCCCTTTGTACAATAGGGAGGGAAGGGGTCTGTGGAACTTCTCTTG

GCAGATACGCCTGCTTCTGCCACAGCCTAGTCCACTTTATCCTGGTGCTCTGAGCCGGGCAGCTAGGAACCCACCCTAAAGAGGCTTAGCATCCAGTTCC

ATAGGTGGGACTGTGTCCGGGGAGGAGGTTCTAGGTCAGGTGAGCCTGTCAGTTATCATTGGCCTCGGTGGCATTCGGGGGATGAAGCTTTTCCACAGAG

GTCACTGTCCTGCTGACGCAGTGCACTGCTTGAAGATGACCAGTCGCTGGGTGTTAACGTAGGAGCCTGAGGTCAAGAGCTAGGAATATTTGCTAGACCC

CCAGCAGGAGGCCCACGGCCCATACAGGAAGGTCTAAGTTTTGAAGGTGGGTGGGGCCTACACCTTTCCACCTCCATGCACACACCCCATAAATCCTACG

ATGGAAGATGTGTGGAGACGAGGGGAATCTCACAATAATGTGGCTCCTGTCTTTCTTCCTGGGAGGCAGGAGTTGGTTGTGTCTGCCCCTTTGCTCCTTG

TCTGTGAATTGCTGTTGACACACACAACTAGTGGGCAAAGGCCAGGGCATGTCACAACCTGGATTTCCTTCACCTTTAATGAGGCACAAGAAGGGACTTC

TCAACTGGCCAGTTGAAGCTTAGCTTACTGGCGTGTTTGGGGGAAGGACGGACACACTGCCACCTCCTCCTCACTGCTCTTTGCCATCAGGTGGCTTTAC

TCATGCTGTTTTTCTGTTTCAGTTTTCCCATCTGGAAAGCATTGGGGAGGGGGAGTTGACCTGCCTCAGGGTGAAAGATCAGGAGTCCTTTGAGTGTGAT

GTGGGTCAACAATGGGTCCCTGTTCCGCTTCCTCTTTGGCGTTAAAGAGGGTCTTAAAACCAAATGCCATTTCCCATACCCCCAAATCTGTGTGTTTCCT

GCCATTGTATCACATGTCTGTCCTGAGTCCTTGGCCCTTCTTGAGCCTCCTGTGTAATCAACATCACGTTTCCAACTATAAATCATAGTGTC
Translation
MPSSCRVKG - UNI20090 - - UNI30101 - - UNI30264 - GWDAMEYDEKLVRFRQAHLNPFNKQLGPRHHEQEPSEKVTSED - UNI20

090 - DTLPELPAGEPEFHYSERMMDLGLSEDHFSRPV - UNI21332 - GLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKLQ

ELK - UNI28478 - DPNEEEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTG GCCYRCHSKCLNLISKPCVSSKVSHQAEYELNIC

PETGLDSQDYRCAECRAPISLR - UNI26019 - RGVPSEARQCDYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRK VSRCSMRYLALMVSRPVLRL

REINPLLFNYVEELVEIR KLRQDILLMKPYFITCKEAMEARLLLQ - UNI7857 - LQDRQHFVENDEMYSIQDLLEVHMGRLSCSLTEIHTLFAKH

IKLDCE RCQAKGFVCELCKEGDVLFPFDSHTSVCNDCSAVFHR RDCYYDNSTTCPKCARLTLRKQSLFQEPGLDMDA
Transcript ENSMUST00000001522
Sequence
ACAGTGTATCAGCGGCGGCGAACTACAGTGTAGCCAGCCGGTCCGGTACAATGTAGCGGCAGCCAG GACATAGTCACATTACCATGCCTAGGTGCAGGG

CAGTCTGGGAAGTCACGTGACAAGAGTGATGCCCTCCTCATGCAGGGTGAAAGG - UNI20090 - - UNI30101 - - UNI30264 - GTGGGA

TGCTATGGAATATGATGAGAAGCTGGTTCGGTTCCGGCAGGCCCACCTCAACCCCTTCAACAAGCAGCTTGGTCCGAGGCATCATGAACAGGAACCCAGT

GAGAAGGTCACTTCTGAAG - UNI20090 - ACACTTTGCCTGAGCTGCCCGCTGGGGAGCCTGAATTCCACTACTCGGAGCGCATGATGGATCTCGG

CCTGTCTGAGGACCACTTTTCCCGCCCTGTG - UNI21332 - GGTCTCTTCCTGGCCTCTGATGTCCAGCAGCTGCGGCAGGCCATCGAAGAATGCA

AACAGGTGATCCTGGAGCTGCCCGAGCAGTCAGAGAAGCAGAAGGACGCTGTGGTGCGGCTGATCCACCTCCGGCTGAAGCTCCAGGAGCTGAAG - UN

I28478 - GACCCCAATGAGGAGGAACCCAACATCCGGGTTCTCCTGGAACATCGCTTCTACAAGGAGAAGAGCAAGAGCGTTAAACAGACCTGCGATA

AGTGCAACACCATCATCTGGGGGCTCATCCAGACCTGGTACACCTGCACAG GGTGTTGTTACCGCTGTCACAGCAAGTGCCTGAACCTCATCTCCAAAC

CATGTGTCAGCTCCAAGGTCAGTCACCAGGCTGAGTATGAGCTGAACATCTGCCCTGAGACCGGGCTGGACAGCCAGGACTACCGCTGTGCGGAGTGCCG

TGCTCCCATCTCTCTGA - UNI26019 - GAGGTGTGCCTAGTGAGGCCCGGCAGTGTGACTACACGGGCCAATACTACTGCAGCCACTGCCACTGGA

ACGACCTGGCTGTCATCCCCGCGAGAGTGGTGCACAACTGGGACTTTGAGCCACGCAAG GTGTCCCGTTGCAGCATGCGCTACCTGGCACTGATGGTGT

CTCGGCCAGTGCTCCGGCTCCGGGAGATTAACCCTTTGCTGTTTAACTACGTGGAAGAGCTGGTGGAGATCCGG AAACTGCGCCAGGACATCCTGCTCA

TGAAGCCATACTTCATCACCTGCAAGGAGGCCATGGAGGCGCGACTACTGCTGCAG - UNI7857 - CTCCAAGACAGACAGCATTTTGTGGAGAACG

ATGAGATGTACTCTATCCAGGACCTCTTGGAAGTGCACATGGGCCGCCTCAGCTGCTCGCTCACTGAGATCCACACGCTCTTCGCCAAGCACATCAAGTT

GGACTGTGAG CGGTGCCAAGCCAAGGGGTTCGTCTGTGAACTCTGCAAAGAAGGGGACGTGCTCTTCCCGTTCGACAGCCACACGTCTGTGTGCAATGA

CTGTTCGGCTGTCTTCCACAG GGACTGTTACTACGACAACTCGACCACGTGCCCCAAGTGTGCCCGGCTCACATTGAGGAAGCAGTCACTATTCCAGGA

ACCTGGCCTAGACATGGATGCCTAGAACACTGGAGAACGCCAGGCACCGTATCCACCCCTCCGGCTGGTGCCTGCTGGCCTTGCCCACCAGATGTGCATT

CTACTCTGGAGACGACCCCCCCCCCCCCAGTATATCCTCCAGACCTCTTCGTCTCGGGCCAGAAGGAAGTGACTAGTGGCCACCGGGACTCATTCCTCAG

GTGCTTGTGGAGACTTCGAGTGTGTATACCTGGCTGTTGATTGGGTGTGCTGCTATCGGGGGGTCAAAATACTGCCTGTGCCCCATTGTAGGACTCCTTA

GGCAGAGGAGCCTGGGTGTGACTCTCCAGGAAGGTGGGGGAGTCGCTCTCTTATGGCACAGAGCCCTCCAGGCCTTTAAAACCAATCCTTCTGCACCATA

GAGATGGCCTTGCTCCTGTCTAGTACACCCTTACAACTGGTCAGAAACTTGAGAGGCCAGTCCAGTAAGACCAGAGGATGCCTCCTGACTGAGTTTTATC

TCTGCTGAGGAAGATTTAGGTTCTACTCAGAGGCACCCAACCCTTTTAGCACCTTGTCTCCTGAGGGACGTCCGGTTTTCTCTGACTGGGGCTGTTCACT

ACTGTGTCCCGTGGATCTTCCCCTGCATCCTGAGAGTTGTCATCGTCATCCTTAATCTGTCAGTCACGTGTGCTTCCCCACCCCCCTTTGTACAATAGGG

AGGGAAGGGGTCTGTGGAACTTCTCTTGGCAGATACGCCTGCTTCTGCCACAGCCTAGTCCACTTTATCCTGGTGCTCTGAGCCGGGCAGCTAGGAACCC

ACCCTAAAGAGGCTTAGCATCCAGTTCCATAGGTGGGACTGTGTCCGGGGAGGAGGTTCTAGGTCAGGTGAGCCTGTCAGTTATCATTGGCCTCGGTGGC

ATTCGGGGGATGAAGCTTTTCCACAGAGGTCACTGTCCTGCTGACGCAGTGCACTGCTTGAAGATGACCAGTCGCTGGGTGTTAACGTAGGAGCCTGAGG

TCAAGAGCTAGGAATATTTGCTAGACCCCCAGCAGGAGGCCCACGGCCCATACAGGAAGGTCTAAGTTTTGAAGGTGGGTGGGGCCTACACCTTTCCACC

TCCATGCACACACCCCATAAATCCTACGATGGAAGATGTGTGGAGACGAGGGGAATCTCACAATAATGTGGCTCCTGTCTTTCTTCCTGGGAGGCAGGAG

TTGGTTGTGTCTGCCCCTTTGCTCCTTGTCTGTGAATTGCTGTTGACACACACAACTAGTGGGCAAAGGCCAGGGCATGTCACAACCTGGATTTCCTTCA

CCTTTAATGAGGCACAAGAAGGGACTTCTCAACTGGCCAGTTGAAGCTTAGCTTACTGGCGTGTTTGGGGGAAGGACGGACACACTGCCACCTCCTCCTC

ACTGCTCTTTGCCATCAGGTGGCTTTACTCATGCTGTTTTTCTGTTTCAGTTTTCCCATCTGGAAAGCATTGGGGAGGGGGAGTTGACCTGCCTCAGGGT

GAAAGATCAGGAGTCCTTTGAGTGTGATGTGGGTCAACAATGGGTCCCTGTTCCGCTTCCTCTTTGGCGTTAAAGAGGGTCTTAAAACCAAATGCCATTT

CCCATACCCCCAAATCTGTGTGTTTCCTGCCATTGTATCACATGTCTGTCCTGAGTCCTTGGCCCTTCTTGAGCCTCCTGTGTAATCAACATCACGTTTC

CAACTATAAATCATAGTGTCTAAAGGAAA
Translation
 MPSSCRVKG - UNI20090 - - UNI30101 - - UNI30264 - GWDAMEYDEKLVRFRQAHLNPFNKQLGPRHHEQEPSEKVTSED - UNI2

0090 - DTLPELPAGEPEFHYSERMMDLGLSEDHFSRPV - UNI21332 - GLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKL

QELK - UNI28478 - DPNEEEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTG GCCYRCHSKCLNLISKPCVSSKVSHQAEYELNI

CPETGLDSQDYRCAECRAPISLR - UNI26019 - RGVPSEARQCDYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRK VSRCSMRYLALMVSRPVLR

LREINPLLFNYVEELVEIR KLRQDILLMKPYFITCKEAMEARLLLQ - UNI7857 - LQDRQHFVENDEMYSIQDLLEVHMGRLSCSLTEIHTLFAK

HIKLDCE RCQAKGFVCELCKEGDVLFPFDSHTSVCNDCSAVFHR RDCYYDNSTTCPKCARLTLRKQSLFQEPGLDMDA
Transcript ENSMUST00000108832
Sequence
GAACTACAGTGTAGCCAGCCGGTCCGGTACAATGTAGCGGCAGCCAG GACATAGTCACATTACCATGCCTAGGTGCAGGGCAGTCTGGGAAGTCACGTG

ACAAGAGTGATGCCCTCCTCATGCAGGGTGAAAGG - UNI30264 - GGAACATCTCAAGTAAGGGGACAGGAAGGAAGATCCAGTTCCAAGAG - U

NI20090 - - UNI30101 - GTGGGATGCTATGGAATATGATGAGAAGCTGGTTCGGTTCCGGCAGGCCCACCTCAACCCCTTCAACAAGCAGCTTG

GTCCGAGGCATCATGAACAGGAACCCAGTGAGAAGGTCACTTCTGAAG - UNI20090 - ACACTTTGCCTGAGCTGCCCGCTGGGGAGCCTGAATTC

CACTACTCGGAGCGCATGATGGATCTCGGCCTGTCTGAGGACCACTTTTCCCGCCCTGTG - UNI21332 - GGTCTCTTCCTGGCCTCTGATGTCCA

GCAGCTGCGGCAGGCCATCGAAGAATGCAAACAGGTGATCCTGGAGCTGCCCGAGCAGTCAGAGAAGCAGAAGGACGCTGTGGTGCGGCTGATCCACCTC

CGGCTGAAGCTCCAGGAGCTGAAG - UNI28478 - GACCCCAATGAGGAGGAACCCAACATCCGGGTTCTCCTGGAACATCGCTTCTACAAGGAGAA

GAGCAAGAGCGTTAAACAGACCTGCGATAAGTGCAACACCATCATCTGGGGGCTCATCCAGACCTGGTACACCTGCACAG GGTGTTGTTACCGCTGTCA

CAGCAAGTGCCTGAACCTCATCTCCAAACCATGTGTCAGCTCCAAGGTCAGTCACCAGGCTGAGTATGAGCTGAACATCTGCCCTGAGACCGGGCTGGAC

AGCCAGGACTACCGCTGTGCGGAGTGCCGTGCTCCCATCTCTCTGA - UNI26019 - GAGGTGTGCCTAGTGAGGCCCGGCAGTGTGACTACACGGG

CCAATACTACTGCAGCCACTGCCACTGGAACGACCTGGCTGTCATCCCCGCGAGAGTGGTGCACAACTGGGACTTTGAGCCACGCAAG GTGTCCCGTTG

CAGCATGCGCTACCTGGCACTGATGGTGTCTCGGCCAGTGCTCCGGCTCCGGGAGATTAACCCTTTGCTGTTTAACTACGTGGAAGAGCTGGTGGAGATC

CGG AAACTGCGCCAGGACATCCTGCTCATGAAGCCATACTTCATCACCTGCAAGGAGGCCATGGAGGCGCGACTACTGCTGCAG - UNI7857 - CT

CCAAGACAGACAGCATTTTGTGGAGAACGATGAGATGTACTCTATCCAGGACCTCTTGGAAGTGCACATGGGCCGCCTCAGCTGCTCGCTCACTGAGATC

CACACGCTCTTCGCCAAGCACATCAAGTTGGACTGTGAG CGGTGCCAAGCCAAGGGGTTCGTCTGTGAACTCTGCAAAGAAGGGGACGTGCTCTTCCCG

TTCGACAGCCACACGTCTGTGTGCAATGACTGTTCGGCTGTCTTCCACAG GGACTGTTACTACGACAACTCGACCACGTGCCCCAAGTGTGCCCGGCTC

ACATTGAGGAAGCAGTCACTATTCCAGGAACCTGGCCTAGACATGGATGCCTAGAACACTGGAGAACGCCAGGCACCGTATCCACCCCTCCGGCTGGTGC

CTGCTGGCCTTGCCCACCAGATGTGCATTCTACTCTGGAGACGACCCCCCCCCCCCCAGTATATCCTCCAGACCTCTTCGTCTCGGGCCAGAAGGAAGTG

ACTAGTGGCCACCGGGACTCATTCCTCAGGTGCTTGTGGAGACTTCGAGTGTGTATACCTGGCTGTTGATTGGGTGTGCTGCTATCGGGGGGTCAAAATA

CTGCCTGTGCCCCATTGTAGGACTCCTTAGGCAGAGGAGCCTGGGTGTGACTCTCCAGGAAGGTGGGGGAGTCGCTCTCTTATGGCACAGAGCCCTCCAG

GCCTTTAAAACCAATCCTTCTGCACCATAGAGATGGCCTTGCTCCTGTCTAGTACACCCTTACAACTGGTCAGAAACTTGAGAGGCCAGTCCAGTAAGAC

CAGAGGATGCCTCCTGACTGAGTTTTATCTCTGCTGAGGAAGATTTAGGTTCTACTCAGAGGCACCCAACCCTTTTAGCACCTTGTCTCCTGAGGGACGT

CCGGTTTTCTCTGACTGGGGCTGTTCACTACTGTGTCCCGTGGATCTTCCCCTGCATCCTGAGAGTTGTCATCGTCATCCTTAATCTGTCAGTCACGTGT

GCTTCCCCACCCCCCTTTGTACAATAGGGAGGGAAGGGGTCTGTGGAACTTCTCTTGGCAGATACGCCTGCTTCTGCCACAGCCTAGTCCACTTTATCCT

GGTGCTCTGAGCCGGGCAGCTAGGAACCCACCCTAAAGAGGCTTAGCATCCAGTTCCATAGGTGGGACTGTGTCCGGGGAGGAGGTTCTAGGTCAGGTGA

GCCTGTCAGTTATCATTGGCCTCGGTGGCATTCGGGGGATGAAGCTTTTCCACAGAGGTCACTGTCCTGCTGACGCAGTGCACTGCTTGAAGATGACCAG

TCGCTGGGTGTTAACGTAGGAGCCTGAGGTCAAGAGCTAGGAATATTTGCTAGACCCCCAGCAGGAGGCCCACGGCCCATACAGGAAGGTCTAAGTTTTG

AAGGTGGGTGGGGCCTACACCTTTCCACCTCCATGCACACACCCCATAAATCCTACGATGGAAGATGTGTGGAGACGAGGGGAATCTCACAATAATGTGG

CTCCTGTCTTTCTTCCTGGGAGGCAGGAGTTGGTTGTGTCTGCCCCTTTGCTCCTTGTCTGTGAATTGCTGTTGACACACACAACTAGTGGGCAAAGGCC

AGGGCATGTCACAACCTGGATTTCCTTCACCTTTAATGAGGCACAAGAAGGGACTTCTCAACTGGCCAGTTGAAGCTTAGCTTACTGGCGTGTTTGGGGG

AAGGACGGACACACTGCCACCTCCTCCTCACTGCTCTTTGCCATCAGGTGGCTTTACTCATGCTGTTTTTCTGTTTCAGTTTTCCCATCTGGAAAGCATT

GGGGAGGGGGAGTTGACCTGCCTCAGGGTGAAAGATCAGGAGTCCTTTGAGTGTGATGTGGGTCAACAATGGGTCCCTGTTCCGCTTCCTCTTTGGCGTT

AAAGAGGGTCTTAAAACCAAATGCCATTTCCCATACCCCCAAATCTGTGTGTTTCCTGCCATTGTATCACATGTCTGTCCTGAGTCCTTGGCCCTTCTTG

AGCCTCCTGTGTAATCAACATCACGTTTCCAACTATAAATCATAGTGTCTAAAGGAAA
Translation
 MQGER - UNI30264 - GTSQVRGQEGRSSSKR - UNI20090 - - UNI30101 - RWDAMEYDEKLVRFRQAHLNPFNKQLGPRHHEQEPSE

KVTSED - UNI20090 - DTLPELPAGEPEFHYSERMMDLGLSEDHFSRPV - UNI21332 - GLFLASDVQQLRQAIEECKQVILELPEQSEKQK

DAVVRLIHLRLKLQELK - UNI28478 - DPNEEEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTG GCCYRCHSKCLNLISKPCVS

SKVSHQAEYELNICPETGLDSQDYRCAECRAPISLR - UNI26019 - RGVPSEARQCDYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRK VSRCSM

RYLALMVSRPVLRLREINPLLFNYVEELVEIR KLRQDILLMKPYFITCKEAMEARLLLQ - UNI7857 - LQDRQHFVENDEMYSIQDLLEVHMGRL

SCSLTEIHTLFAKHIKLDCE RCQAKGFVCELCKEGDVLFPFDSHTSVCNDCSAVFHR RDCYYDNSTTCPKCARLTLRKQSLFQEPGLDMDA
Transcript ENSMUST00000065534
Sequence
AGCGGCGGCGAACTACAGTGTAGCCAGCCGGTCCGGTACAATGTAGCGGCAGCCAG - UNI20090 - - UNI30101 - - UNI30264 - GTGG

GATGCTATGGAATATGATGAGAAGCTGGTTCGGTTCCGGCAGGCCCACCTCAACCCCTTCAACAAGCAGCTTGGTCCGAGGCATCATGAACAGGAACCCA

GTGAGAAGGTCACTTCTGAAG - UNI20090 - ACACTTTGCCTGAGCTGCCCGCTGGGGAGCCTGAATTCCACTACTCGGAGCGCATGATGGATCTC

GGCCTGTCTGAGGACCACTTTTCCCGCCCTGTG - UNI21332 - GGTCTCTTCCTGGCCTCTGATGTCCAGCAGCTGCGGCAGGCCATCGAAGAATG

CAAACAGGTGATCCTGGAGCTGCCCGAGCAGTCAGAGAAGCAGAAGGACGCTGTGGTGCGGCTGATCCACCTCCGGCTGAAGCTCCAGGAGCTGAAG - 

UNI28478 - GACCCCAATGAGGAGGAACCCAACATCCGGGTTCTCCTGGAACATCGCTTCTACAAGGAGAAGAGCAAGAGCGTTAAACAGACCTGCGA

TAAGTGCAACACCATCATCTGGGGGCTCATCCAGACCTGGTACACCTGCACAG GGTGTTGTTACCGCTGTCACAGCAAGTGCCTGAACCTCATCTCCAA

ACCATGTGTCAGCTCCAAGGTCAGTCACCAGGCTGAGTATGAGCTGAACATCTGCCCTGAGACCGGGCTGGACAGCCAGGACTACCGCTGTGCGGAGTGC

CGTGCTCCCATCTCTCTGA - UNI26019 - GAGGTGTGCCTAGTGAGGCCCGGCAGTGTGACTACACGGGCCAATACTACTGCAGCCACTGCCACTG

GAACGACCTGGCTGTCATCCCCGCGAGAGTGGTGCACAACTGGGACTTTGAGCCACGCAAG GTGTCCCGTTGCAGCATGCGCTACCTGGCACTGATGGT

GTCTCGGCCAGTGCTCCGGCTCCGGGAGATTAACCCTTTGCTGTTTAACTACGTGGAAGAGCTGGTGGAGATCCGG AAACTGCGCCAGGACATCCTGCT

CATGAAGCCATACTTCATCACCTGCAAGGAGGCCATGGAGGCGCGACTACTGCTGCAG - UNI7857 - CTCCAAGACAGACAGCATTTTGTGGAGAA

CGATGAGATGTACTCTATCCAGGACCTCTTGGAAGTGCACATGGGCCGCCTCAGCTGCTCGCTCACTGAGATCCACACGCTCTTCGCCAAGCACATCAAG

TTGGACTGTGAG CGGTGCCAAGCCAAGGGGTTCGTCTGTGAACTCTGCAAAGAAGGGGACGTGCTCTTCCCGTTCGACAGCCACACGTCTGTGTGCAAT

GACTGTTCGGCTGTCTTCCACAG GGACTGTTACTACGACAACTCGACCACGTGCCCCAAGTGTGCCCGGCTCACATTGAGGAAGCAGTCACTATTCCAG

GAACCTGGCCTAGACATGGATGCCTAGAACACTGGAGAACGCCAGGCACCGTATCCACCCCTCCGGCTGGTGCCTGCTGGCCTTGCCCACCAGATGTGCA

TTCTACTCTGGAGACGACCCCCCCCCCCCCAGTATATCCTCCAGACCTCTTCGTCTCGGGCCAGAAGGAAGTGACTAGTGGCCACCGGGACTCATTCCTC

AGGTGCTTGTGGAGACTTCGAGTGTGTATACCTGGCTGTTGATTGGGTGTGCTGCTATCGGGGGGTCAAAATACTGCCTGTGCCCCATTGTAGGACTCCT

TAGGCAGAGGAGCCTGGGTGTGACTCTCCAGGAAGGTGGGGGAGTCGCTCTCTTATGGCACAGAGCCCTCCAGGCCTTTAAAACCAATCCTTCTGCACCA

TAGAGATGGCCTTGCTCCTGTCTAGTACACCCTTACAACTGGTCAGAAACTTGAGAGGCCAGTCCAGTAAGACCAGAGGATGCCTCCTGACTGAGTTTTA

TCTCTGCTGAGGAAGATTTAGGTTCTACTCAGAGGCACCCAACCCTTTTAGCACCTTGTCTCCTGAGGGACGTCCGGTTTTCTCTGACTGGGGCTGTTCA

CTACTGTGTCCCGTGGATCTTCCCCTGCATCCTGAGAGTTGTCATCGTCATCCTTAATCTGTCAGTCACGTGTGCTTCCCCACCCCCCTTTGTACAATAG

GGAGGGAAGGGGTCTGTGGAACTTCTCTTGGCAGATACGCCTGCTTCTGCCACAGCCTAGTCCACTTTATCCTGGTGCTCTGAGCCGGGCAGCTAGGAAC

CCACCCTAAAGAGGCTTAGCATCCAGTTCCATAGGTGGGACTGTGTCCGGGGAGGAGGTTCTAGGTCAGGTGAGCCTGTCAGTTATCATTGGCCTCGGTG

GCATTCGGGGGATGAAGCTTTTCCACAGAGGTCACTGTCCTGCTGACGCAGTGCACTGCTTGAAGATGACCAGTCGCTGGGTGTTAACGTAGGAGCCTGA

GGTCAAGAGCTAGGAATATTTGCTAGACCCCCAGCAGGAGGCCCACGGCCCATACAGGAAGGTCTAAGTTTTGAAGGTGGGTGGGGCCTACACCTTTCCA

CCTCCATGCACACACCCCATAAATCCTACGATGGAAGATGTGTGGAGACGAGGGGAATCTCACAATAATGTGGCTCCTGTCTTTCTTCCTGGGAGGCAGG

AGTTGGTTGTGTCTGCCCCTTTGCTCCTTGTCTGTGAATTGCTGTTGACACACACAACTAGTGGGCAAAGGCCAGGGCATGTCACAACCTGGATTTCCTT

CACCTTTAATGAGGCACAAGAAGGGACTTCTCAACTGGCCAGTTGAAGCTTAGCTTACTGGCGTGTTTGGGGGAAGGACGGACACACTGCCACCTCCTCC

TCACTGCTCTTTGCCATCAGGTGGCTTTACTCATGCTGTTTTTCTGTTTCAGTTTTCCCATCTGGAAAGCATTGGGGAGGGGGAGTTGACCTGCCTCAGG

GTGAAAGATCAGGAGTCCTTTGAGTGTGATGTGGGTCAACAATGGGTCCCTGTTCCGCTTCCTCTTTGGCGTTAAAGAGGGTCTTAAAACCAAATGCCAT

TTCCCATACCCCCAAATCTGTGTGTTTCCTGCCATTGTATCACATGTCTGTCCTGAGTCCTTGGCCCTTCTTGAGCCTCCTGTGTAATCAACATCACGTT

TCCAACTATAAATCATAGTGTC
Translation
 - UNI20090 - - UNI30101 - - UNI30264 - MEYDEKLVRFRQAHLNPFNKQLGPRHHEQEPSEKVTSED - UNI20090 - DTLPELP

AGEPEFHYSERMMDLGLSEDHFSRPV - UNI21332 - GLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKLQELK - UNI2847

8 - DPNEEEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTG GCCYRCHSKCLNLISKPCVSSKVSHQAEYELNICPETGLDSQDYRCA

ECRAPISLR - UNI26019 - RGVPSEARQCDYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRK VSRCSMRYLALMVSRPVLRLREINPLLFNYVEE

LVEIR KLRQDILLMKPYFITCKEAMEARLLLQ - UNI7857 - LQDRQHFVENDEMYSIQDLLEVHMGRLSCSLTEIHTLFAKHIKLDCE RCQAKG

FVCELCKEGDVLFPFDSHTSVCNDCSAVFHR RDCYYDNSTTCPKCARLTLRKQSLFQEPGLDMDA
Transcript ENSMUST00000108830
Sequence
ACAGATGCCGACCCCCACCCCCAATCACCGGGTGGCTTCAGAGCCTGAGTATGGGACTCCCGGCCCAAGGACCCGCAGGGACTCGCCTTCTGCTATGTTG

AGCTTTTCTGAGCCTTCGGTTTCACAACTATGAAATGG - UNI20090 - - UNI30101 - - UNI30264 - GTGGGATGCTATGGAATATGAT

GAGAAGCTGGTTCGGTTCCGGCAGGCCCACCTCAACCCCTTCAACAAGCAGCTTGGTCCGAGGCATCATGAACAGGAACCCAGTGAGAAGGTCACTTCTG

AAG - UNI20090 - ACACTTTGCCTGAGCTGCCCGCTGGGGAGCCTGAATTCCACTACTCGGAGCGCATGATGGATCTCGGCCTGTCTGAGGACCAC

TTTTCCCGCCCTGTG - UNI21332 - GGTCTCTTCCTGGCCTCTGATGTCCAGCAGCTGCGGCAGGCCATCGAAGAATGCAAACAGGTGATCCTGGA

GCTGCCCGAGCAGTCAGAGAAGCAGAAGGACGCTGTGGTGCGGCTGATCCACCTCCGGCTGAAGCTCCAGGAGCTGAAG - UNI28478 - GACCCCA

ATGAGGAGGAACCCAACATCCGGGTTCTCCTGGAACATCGCTTCTACAAGGAGAAGAGCAAGAGCGTTAAACAGACCTGCGATAAGTGCAACACCATCAT

CTGGGGGCTCATCCAGACCTGGTACACCTGCACAG GGTGTTGTTACCGCTGTCACAGCAAGTGCCTGAACCTCATCTCCAAACCATGTGTCAGCTCCAA

GGTCAGTCACCAGGCTGAGTATGAGCTGAACATCTGCCCTGAGACCGGGCTGGACAGCCAGGACTACCGCTGTGCGGAGTGCCGTGCTCCCATCTCTCTG

A - UNI26019 - GAGGTGTGCCTAGTGAGGCCCGGCAGTGTGACTACACGGGCCAATACTACTGCAGCCACTGCCACTGGAACGACCTGGCTGTCAT

CCCCGCGAGAGTGGTGCACAACTGGGACTTTGAGCCACGCAAG GTGTCCCGTTGCAGCATGCGCTACCTGGCACTGATGGTGTCTCGGCCAGTGCTCCG

GCTCCGGGAGATTAACCCTTTGCTGTTTAACTACGTGGAAGAGCTGGTGGAGATCCGG AAACTGCGCCAGGACATCCTGCTCATGAAGCCATACTTCAT

CACCTGCAAGGAGGCCATGGAGGCGCGACTACTGCTGCAG - UNI7857 - CTCCAAGACAGACAGCATTTTGTGGAGAACGATGAGATGTACTCTAT

CCAGGACCTCTTGGAAGTGCACATGGGCCGCCTCAGCTGCTCGCTCACTGAGATCCACACGCTCTTCGCCAAGCACATCAAGTTGGACTGTGAG CGGTG

CCAAGCCAAGGGGTTCGTCTGTGAACTCTGCAAAGAAGGGGACGTGCTCTTCCCGTTCGACAGCCACACGTCTGTGTGCAATGACTGTTCGGCTGTCTTC

CACAG GGACTGTTACTACGACAACTCGACCACGTGCCCCAAGTGTGCCCGGCTCACATTGAGGAAGCAGTCACTATTCCAGGAACCTGGCCTAGACATG

GATGCCTAGAACACTGGAGAACGCCAGGCACCGTATCCACCCCTCCGGCTGGTGCCTGCTGGCCTTGCCCACCAGATGTGCATTCTACTCTGGAGACGAC

CCCCCCCCCCCCAGTATATCCTCCAGACCTCTTCGTCTCGGGCCAGAAGGAAGTGACTAGTGGCCACCGGGACTCATTCCTCAGGTGCTTGTGGAGACTT

CGAGTGTGTATACCTGGCTGTTGATTGGGTGTGCTGCTATCGGGGGGTCAAAATACTGCCTGTGCCCCATTGTAGGACTCCTTAGGCAGAGGAGCCTGGG

TGTGACTCTCCAGGAAGGTGGGGGAGTCGCTCTCTTATGGCACAGAGCCCTCCAGGCCTTTAAAACCAATCCTTCTGCACCATAGAGATGGCCTTGCTCC

TGTCTAGTACACCCTTACAACTGGTCAGAAACTTGAGAGGCCAGTCCAGTAAGACCAGAGGATGCCTCCTGACTGAGTTTTATCTCTGCTGAGGAAGATT

TAGGTTCTACTCAGAGGCACCCAACCCTTTTAGCACCTTGTCTCCTGAGGGACGTCCGGTTTTCTCTGACTGGGGCTGTTCACTACTGTGTCCCGTGGAT

CTTCCCCTGCATCCTGAGAGTTGTCATCGTCATCCTTAATCTGTCAGTCACGTGTGCTTCCCCACCCCCCTTTGTACAATAGGGAGGGAAGGGGTCTGTG

GAACTTCTCTTGGCAGATACGCCTGCTTCTGCCACAGCCTAGTCCACTTTATCCTGGTGCTCTGAGCCGGGCAGCTAGGAACCCACCCTAAAGAGGCTTA

GCATCCAGTTCCATAGGTGGGACTGTGTCCGGGGAGGAGGTTCTAGGTCAGGTGAGCCTGTCAGTTATCATTGGCCTCGGTGGCATTCGGGGGATGAAGC

TTTTCCACAGAGGTCACTGTCCTGCTGACGCAGTGCACTGCTTGAAGATGACCAGTCGCTGGGTGTTAACGTAGGAGCCTGAGGTCAAGAGCTAGGAATA

TTTGCTAGACCCCCAGCAGGAGGCCCACGGCCCATACAGGAAGGTCTAAGTTTTGAAGGTGGGTGGGGCCTACACCTTTCCACCTCCATGCACACACCCC

ATAAATCCTACGATGGAAGATGTGTGGAGACGAGGGGAATCTCACAATAATGTGGCTCCTGTCTTTCTTCCTGGGAGGCAGGAGTTGGTTGTGTCTGCCC

CTTTGCTCCTTGTCTGTGAATTGCTGTTGACACACACAACTAGTGGGCAAAGGCCAGGGCATGTCACAACCTGGATTTCCTTCACCTTTAATGAGGCACA

AGAAGGGACTTCTCAACTGGCCAGTTGAAGCTTAGCTTACTGGCGTGTTTGGGGGAAGGACGGACACACTGCCACCTCCTCCTCACTGCTCTTTGCCATC

AGGTGGCTTTACTCATGCTGTTTTTCTGTTTCAGTTTTCCCATCTGGAAAGCATTGGGGAGGGGGAGTTGACCTGCCTCAGGGTGAAAGATCAGGAGTCC

TTTGAGTGTGATGTGGGTCAACAATGGGTCCCTGTTCCGCTTCCTCTTTGGCGTTAAAGAGGGTCTTAAAACCAAATGCCATTTCCCATACCCCCAAATC

TGTGTGTTTCCTGCCATTGTATCACATGTCTGTCCTGAGTCCTTGGCCCTTCTTGAGCCTCCTGTGTAATCAACATCACGTTTCCAACTATAAATCATAG

TGTCT
Translation
 - UNI20090 - - UNI30101 - - UNI30264 - MEYDEKLVRFRQAHLNPFNKQLGPRHHEQEPSEKVTSED - UNI20090 - DTLPELP

AGEPEFHYSERMMDLGLSEDHFSRPV - UNI21332 - GLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKLQELK - UNI2847

8 - DPNEEEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTG GCCYRCHSKCLNLISKPCVSSKVSHQAEYELNICPETGLDSQDYRCA

ECRAPISLR - UNI26019 - RGVPSEARQCDYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRK VSRCSMRYLALMVSRPVLRLREINPLLFNYVEE

LVEIR KLRQDILLMKPYFITCKEAMEARLLLQ - UNI7857 - LQDRQHFVENDEMYSIQDLLEVHMGRLSCSLTEIHTLFAKHIKLDCE RCQAKG

FVCELCKEGDVLFPFDSHTSVCNDCSAVFHR RDCYYDNSTTCPKCARLTLRKQSLFQEPGLDMDA
Transcript ENSMUST00000093049
Sequence
ACAGTGTATCAGCGGCGGCGAACTACAGTGTAGCCAGCCGGTCCGGTACAATGTAGCGGCAGCCAG - UNI20090 - - UNI30101 - - UNI30

264 - GTGGGATGCTATGGAATATGATGAGAAGCTGGTTCGGTTCCGGCAGGCCCACCTCAACCCCTTCAACAAGCAGCTTGGTCCGAGGCATCATGAA

CAGGAACCCAGTGAGAAGGTCACTTCTGAAG - UNI20090 - ACACTTTGCCTGAGCTGCCCGCTGGGGAGCCTGAATTCCACTACTCGGAGCGCAT

GATGGATCTCGGCCTGTCTGAGGACCACTTTTCCCGCCCTGTG - UNI21332 - GGTCTCTTCCTGGCCTCTGATGTCCAGCAGCTGCGGCAGGCCA

TCGAAGAATGCAAACAGGTGATCCTGGAGCTGCCCGAGCAGTCAGAGAAGCAGAAGGACGCTGTGGTGCGGCTGATCCACCTCCGGCTGAAGCTCCAGGA

GCTGAAG - UNI28478 - GACCCCAATGAGGAGGAACCCAACATCCGGGTTCTCCTGGAACATCGCTTCTACAAGGAGAAGAGCAAGAGCGTTAAAC

AGACCTGCGATAAGTGCAACACCATCATCTGGGGGCTCATCCAGACCTGGTACACCTGCACAG GGTGTTGTTACCGCTGTCACAGCAAGTGCCTGAACC

TCATCTCCAAACCATGTGTCAGCTCCAAGGTCAGTCACCAGGCTGAGTATGAGCTGAACATCTGCCCTGAGACCGGGCTGGACAGCCAGGACTACCGCTG

TGCGGAGTGCCGTGCTCCCATCTCTCTGA - UNI26019 - GAGGTGTGCCTAGTGAGGCCCGGCAGTGTGACTACACGGGCCAATACTACTGCAGCC

ACTGCCACTGGAACGACCTGGCTGTCATCCCCGCGAGAGTGGTGCACAACTGGGACTTTGAGCCACGCAAG GTGTCCCGTTGCAGCATGCGCTACCTGG

CACTGATGGTGTCTCGGCCAGTGCTCCGGCTCCGGGAGATTAACCCTTTGCTGTTTAACTACGTGGAAGAGCTGGTGGAGATCCGG AAACTGCGCCAGG

ACATCCTGCTCATGAAGCCATACTTCATCACCTGCAAGGAGGCCATGGAGGCGCGACTACTGCTGCAG - UNI7857 - CTCCAAGACAGACAGCATT

TTGTGGAGAACGATGAGATGTACTCTATCCAGGACCTCTTGGAAGTGCACATGGGCCGCCTCAGCTGCTCGCTCACTGAGATCCACACGCTCTTCGCCAA

GCACATCAAGTTGGACTGTGAG CGGTGCCAAGCCAAGGGGTTCGTCTGTGAACTCTGCAAAGAAGGGGACGTGCTCTTCCCGTTCGACAGCCACACGTC

TGTGTGCAATGACTGTTCGGCTGTCTTCCACAGGTGGGTGAGGCCTGTAGCTCACTCTCGGCTAGGTGTGGAGGCCCCTCCCCACTTTCTAAGCAGAATG

CCTTCCCTTGTCCTCGGCTGCAGCTGGTCTGGTGGAACCTGGCACTGCTGCCCTGAGAGAGGAGACAGACATTGGGCTTTCGCTGTCTTTCTTTCAAAGT

CCTTTGCTGGAGTTAGGCCCTGGTGTCTATGTCTAAACTAAAAGTTCTATTAAGGGGTGGGGAATGTAGTCTAATATACATGAAATCTTGTGTTTGATTT

CAAGCACAGAATAGAGGTAGGTCTAGTGGTAAAAAACCTGTAATCTTTATTTATTTTGGGCATAAGTCATAACTTACTATTTTTATTATTTATTTGCTTA

TTTATCTACTATGTATATATCATACAGCTTTCTGCCTATATGTATGCCTGCAGGCCAGAAGAGGGCATCAGATCTCATTACAGATGGGTTGTCAGCCACC

ATGTGGTTGCTGGGAATTAAACTCAGGACCTCTGGAAGAGCAGTCAGTGCTCTTAACCTCTGAGCCACCTCTCCAGCCCTATTATTATTATTATTATTAT

TATTAAATCTTTTTTTAAGTCT
Translation
 - UNI20090 - - UNI30101 - - UNI30264 - MEYDEKLVRFRQAHLNPFNKQLGPRHHEQEPSEKVTSED - UNI20090 - DTLPELP

AGEPEFHYSERMMDLGLSEDHFSRPV - UNI21332 - GLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKLQELK - UNI2847

8 - DPNEEEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTG GCCYRCHSKCLNLISKPCVSSKVSHQAEYELNICPETGLDSQDYRCA

ECRAPISLR - UNI26019 - RGVPSEARQCDYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRK VSRCSMRYLALMVSRPVLRLREINPLLFNYVEE

LVEIR KLRQDILLMKPYFITCKEAMEARLLLQ - UNI7857 - LQDRQHFVENDEMYSIQDLLEVHMGRLSCSLTEIHTLFAKHIKLDCE RCQAKG

FVCELCKEGDVLFPFDSHTSVCNDCSAVFHRWVRPVAHSRLGVEAPPHFLSRMPSLVLGCSWSGGTWHCCPERGDRHWAFAVFLSKSFAGVRPWCLCLN

For any suggestions or comments, please send an email to unitrap@crg.es