Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001508 (Sgca)
Chromosomal location
Chr 11: 94824105 - 94837641 (-)
Description
sarcoglycan, alpha (dystrophin-associated glycoprotein) Gene [Source:MGI (curated);Acc:Sgca-001]
RefSeq_dna
NM_009161 
RefSeq_peptide
NP_001129552.1 NP_033187.1 
UniGene
Mm.18709 
MGI
MGI:894698 
Uniprot/SWISSPROT
P82350 
Uniprot/SPTREMBL
Q5SWB0 Q5SWB2 Q5SWB4 
Human Ortholog
ENSG00000108823 (SGCA)
Omim 608099 - MUSCULAR DYSTROPHY, LIMB-GIRDLE, TYPE 2D  
UniTrap UNI13932
Vector Insertion
Chr 11: 94824714 - 94830372
Public Clones CMHD-GT_415G12-3 (cmhd) CMHD-GT_169B1-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100551
Sequence
CCCCGGGCAACTATGGCAGCAGCAGTAACTTGGATACCTCTCCTGGCAG GTCTCCTGGCAGGACTGAGGGACACCAAGGCCCAGCAGACAACTTTACAC

CTACTTGTGGGTCGTGTGTTTGTGCATCCTTTGGAACATGCCACCTTCCTGCGCCTTCCAGAACACGTTG CGGTGCCACCCACTGTCCGACTCACCTAC

CACGCTCACCTCCAGGGACATCCAGACCTGCCCAGGTGGCTGCACTACACACAGCGCAGTCCCTATAACCCTGGCTTCCTCTACGGCTCCCCCACTCCAG

AAGATCGTGGGTACCAAGTCATCGAG GTCACAGCCTACAATCGAGACAGTTTTGACACCACTAGACAGAGGCTGCTGCTGCTGATTGGGGACCCCGAAG

 GTCCCCGGTTGCCATACCAAGCTGAGTTCCTGGTGCGCAGCCATGATGTGGAGGAGGTGCTGCCCACCACACCTGCCAACCGCTTCCTCACCGCCTTGG

GGGGACTGTGGGAGCCAGGAGAGCTTCAGCTGCTCAACATCACTTCCGCCTTGGACCGGGGAGGCCGAGTCCCTCTTCCTATTGAGGGACGGAAGGAAGG

 GGTATACATTAAGGTAGGCTCTGCCACACCCTTCTCCACCTGCCTGAAGATGGTGGCGTCGCCCGACAGCTATGCCCGTTGTGCCCAGGGACAGCCTCC

ACTACTGTCCTGCTACGACACTTTGGCACCCCACTTCCGCGTTGACTGGTGCAATGTGTCTCTG GTAGACAAGTCAGTACCCGAGCCCCTGGATGAGGT

ACCTACTCCAGGCGATGGGATCTTGGAGCACGACCCGTTCTTCTGCCCACCCACTGAAGCCACAGACCGAGACTTCCTGACAGATGCCTTGGTGACCCTC

TTGGTGCCTTTGTTGGTGGCTCTGCTGCTTACTCTGTTGCTGGCTTACATCATGTGCTTTCGGCGTGAAGGACG GCTGAAGAGAGACATGGCCACCTCT

GA - UNI13932 - CATCCAGATGTTTCACCACTGTTCCATCCATGGGAATACAGAAGAGCTTCGGCAGATGGCAGCCAGCCGAGAGGTGCCCCGGCC

TCTTTCCACCTTGCCCATGTTTAATGTTCGTACAGGAGAGCGGTTACCTCCCCGAGTAGACAGCGCACAGATGCCTCTTATCCTGGACCAGCACTGAAAG

CCCTGCCAAGATGG GTGCTCACAGTACTGGAACTGTGCCACAACTGCCAACCAGTCAGGGCTGGAGGGTCAGGATAAGGGAGAGAGGATTCTGGAACCT

CCCACTCTGTCCTCTACATGACCTTGTAGCTCCAGCTCCAGCTGCACCACTCAGAGATGCTGACCTGTGAATATGTCTACAACTGACTCCAGCTCCTAGC

CTACTTGGACCTCCGGCTCCACAAAGGCAGACAGATGGTGTAGGGAGGGCTGAGGGCATTTGGAGTCAGCACCCAAAAATAAAAAAAATACCTGCTGCTT

CTGC
Translation
MAAAVTWIPLLAG GLLAGLRDTKAQQTTLHLLVGRVFVHPLEHATFLRLPEHVA AVPPTVRLTYHAHLQGHPDLPRWLHYTQRSPYNPGFLYGSPTPE

DRGYQVIE VTAYNRDSFDTTRQRLLLLIGDPEG GPRLPYQAEFLVRSHDVEEVLPTTPANRFLTALGGLWEPGELQLLNITSALDRGGRVPLPIEGRK

EG GVYIKVGSATPFSTCLKMVASPDSYARCAQGQPPLLSCYDTLAPHFRVDWCNVSL VDKSVPEPLDEVPTPGDGILEHDPFFCPPTEATDRDFLTDA

LVTLLVPLLVALLLTLLLAYIMCFRREGR RLKRDMATSD - UNI13932 - DIQMFHHCSIHGNTEELRQMAASREVPRPLSTLPMFNVRTGERLPP

RVDSAQMPLILDQH 
Transcript ENSMUST00000103162
Sequence
CAGGAGATATCAAGGTGATCTGGGCACAAATGCCTGTCTGTGAGCCTGAGTGGAGGCTGACTCTGGAGATTCTGTGACTCTCAGGGGACACCCAGGGTGG

TCAGGTGGGAAGCACGAAGGCAAAGGGACAAGGACAAAGTAACTTGCCCAGTCGTCACCTGAATGGAAACCTGAACTGAGACATCTTTGCTTGGACATTC

AAGGTGTGGGGAG CCCCTGTCCCTGTCACTCACTGGCTAGGCCCCGGGCAACTATGGCAGCAGCAGTAACTTGGATACCTCTCCTGGCAG GTCTCCTG

GCAGGACTGAGGGACACCAAGGCCCAGCAGACAACTTTACACCTACTTGTGGGTCGTGTGTTTGTGCATCCTTTGGAACATGCCACCTTCCTGCGCCTTC

CAGAACACGTTG CGGTGCCACCCACTGTCCGACTCACCTACCACGCTCACCTCCAGGGACATCCAGACCTGCCCAGGTGGCTGCACTACACACAGCGCA

GTCCCTATAACCCTGGCTTCCTCTACGGCTCCCCCACTCCAGAAGATCGTGGGTACCAAGTCATCGAG GTCACAGCCTACAATCGAGACAGTTTTGACA

CCACTAGACAGAGGCTGCTGCTGCTGATTGGGGACCCCGAAG GTCCCCGGTTGCCATACCAAGCTGAGTTCCTGGTGCGCAGCCATGATGTGGAGGAGG

TGCTGCCCACCACACCTGCCAACCGCTTCCTCACCGCCTTGGGGGGACTGTGGGAGCCAGGAGAGCTTCAGCTGCTCAACATCACTTCCGCCTTGGACCG

GGGAGGCCGAGTCCCTCTTCCTATTGAGGGACGGAAGGAAGG GGTATACATTAAGGTAGGCTCTGCCACACCCTTCTCCACCTGCCTGAAGATGGTGGC

GTCGCCCGACAGCTATGCCCGTTGTGCCCAGGGACAGCCTCCACTACTGTCCTGCTACGACACTTTGGCACCCCACTTCCGCGTTGACTGGTGCAATGTG

TCTCTG GTAGACAAGTCAGTACCCGAGCCCCTGGATGAGGTACCTACTCCAGGCGATGGGATCTTGGAGCACGACCCGTTCTTCTGCCCACCCACTGAA

GCCACAGACCGAGACTTCCTGACAGATGCCTTGGTGACCCTCTTGGTGCCTTTGTTGGTGGCTCTGCTGCTTACTCTGTTGCTGGCTTACATCATGTGCT

TTCGGCGTGAAGGACG GCTGAAGAGAGACATGGCCACCTCTGA - UNI13932 - CATCCAGATGTTTCACCACTGTTCCATCCATGGGAATACAGA

AGAGCTTCGGCAGATGGCAGCCAGCCGAGAGGTGCCCCGGCCTCTTTCCACCTTGCCCATGTTTAATGTTCGTACAGGAGAGCGGTTACCTCCCCGAGTA

GACAGCGCACAGATGCCTCTTATCCTGGACCAGCACTGAAAGCCCTGCCAAGATGG GTGCTCACAGTACTGGAACTGTGCCACAACTGCCAACCAGTCA

GGGCTGGAGGGTCAGGATAAGGGAGAGAGGATTCTGGAACCTCCCACTCTGTCCTCTACATGACCTTGTAGCTCCAGCTCCAGCTGCACCACTCAGAGAT

GCTGACCTGTGAATATGTCTACAACTGACTCCAGCTCCTAGCCTACTTGGACCTCCGGCTCCACAAAGGCAGACAGATGGTGTAGGGAGGGCTGAGGGCA

TTTGGAGTCAGCACCCAAAAATAAAAAAAATACCTGCTGCTTCTGCT
Translation
 MAAAVTWIPLLAG GLLAGLRDTKAQQTTLHLLVGRVFVHPLEHATFLRLPEHVA AVPPTVRLTYHAHLQGHPDLPRWLHYTQRSPYNPGFLYGSPTP

EDRGYQVIE VTAYNRDSFDTTRQRLLLLIGDPEG GPRLPYQAEFLVRSHDVEEVLPTTPANRFLTALGGLWEPGELQLLNITSALDRGGRVPLPIEGR

KEG GVYIKVGSATPFSTCLKMVASPDSYARCAQGQPPLLSCYDTLAPHFRVDWCNVSL VDKSVPEPLDEVPTPGDGILEHDPFFCPPTEATDRDFLTD

ALVTLLVPLLVALLLTLLLAYIMCFRREGR RLKRDMATSD - UNI13932 - DIQMFHHCSIHGNTEELRQMAASREVPRPLSTLPMFNVRTGERLP

PRVDSAQMPLILDQH 

For any suggestions or comments, please send an email to unitrap@crg.es