Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001552 (Jup)
Chromosomal location
Chr 11: 100231935 - 100259077 (-)
Description
junction plakoglobin Gene [Source:MGI (curated);Acc:Jup-001]
RefSeq_dna
NM_010593 
RefSeq_peptide
NP_034723.1 
UniGene
Mm.299774 
MGI
MGI:96650 
Uniprot/SWISSPROT
Q02257 
Uniprot/SPTREMBL
A2A4H7 
Human Ortholog
ENSG00000173801 (JUP)
Omim 601214 - NAXOS DISEASE  611528 - ARRHYTHMOGENIC RIGHT VENTRICULAR DYSPLASIA, FAMILIAL, 12  
UniTrap UNI20080
Vector Insertion
Chr 11: 100258949 - 100259064
Public Clones not available
Private Clones OST373561 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19549
Vector Insertion
Chr 11: 100247486 - 100247700
Public Clones not available
Private Clones OST389042 (lexicon) OST368835 (lexicon) OST270758 (lexicon) OST262825 (lexicon)
OST237830 (lexicon) OST232399 (lexicon) OST231538 (lexicon) OST215967 (lexicon)
OST189395 (lexicon) OST188996 (lexicon) OST118722 (lexicon) OST99271 (lexicon)
OST69033 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29544
Vector Insertion
Chr 11: 100247486 - 100259064
Public Clones (sanger) D177E05 (ggtc) D135B12 (ggtc) D152C03 (ggtc) D068H11 (ggtc)
E076G10 (ggtc) D136H02 (ggtc) D103A05 (ggtc) M123D11 (ggtc) D148A12 (ggtc)
D007A01 (ggtc) D177F06 (ggtc) E129C04 (ggtc) IST14189E3 (tigm) IST10292E8 (tigm)
IST10239F11 (tigm) IST14817H4 (tigm) IST14714B6 (tigm) IST14989G1 (tigm)
IST11867C2 (tigm) IST14997F6 (tigm) IST10030F8 (tigm) IST14645D11 (tigm)
IST14689F8 (tigm) IST14424C2 (tigm) IST14450F4 (tigm) IST14204A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25850
Vector Insertion
Chr 11: 100244969 - 100247486
Public Clones D108A09 (ggtc) CMHD-GT_518H2-5S (cmhd) IST10349A8 (tigm) IST12911F11 (tigm)
IST11084B11 (tigm)
Private Clones OST157954 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37101
Vector Insertion
Chr 11: 100244560 - 100244708
Public Clones CMHD-GT_518H2-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33428
Vector Insertion
Chr 11: 100239402 - 100240940
Public Clones IST14316C11 (tigm) IST12904B12 (tigm) IST14164F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12938
Vector Insertion
Chr 11: 100238313 - 100239402
Public Clones CMHD-GT_350D6-3 (cmhd) IST13492A2 (tigm) IST12904B12 (tigm) IST13204E3 (tigm)
IST11245B4 (tigm) IST14316C11 (tigm) IST10010A2 (tigm) IST11733A6 (tigm)
IST13137F12 (tigm) IST11734H6 (tigm)
Private Clones OST97628 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2261
Vector Insertion
Chr 11: 100235791 - 100238036
Public Clones AK0197 (sanger) CMHD-GT_329D11-3 (cmhd) CMHD-GT_265H11-3 (cmhd) CMHD-GT_539G11-5S (cmhd)
CMHD-GT_402E5-3 (cmhd) (cmhd) CMHD-GT_320B2-3 (cmhd) CMHD-GT_474C10-3 (cmhd)
IST14936G12 (tigm) IST10336H1 (tigm) IST10336E1 (tigm) IST12362C1 (tigm)
IST14708C2 (tigm) IST13821G9 (tigm) IST14878A6 (tigm) IST14760H8 (tigm)
IST13656C3 (tigm) IST13375H11 (tigm) IST14942B5 (tigm) IST15050F7 (tigm)
Private Clones OST467170 (lexicon) OST432271 (lexicon) OST412445 (lexicon) OST380438 (lexicon)
OST368825 (lexicon) OST368316 (lexicon) OST302793 (lexicon) OST293452 (lexicon)
OST293217 (lexicon) OST286724 (lexicon) OST268110 (lexicon) OST235658 (lexicon)
OST199097 (lexicon) OST199067 (lexicon) OST198473 (lexicon) OST171812 (lexicon)
OST167805 (lexicon) OST131174 (lexicon) OST129396 (lexicon) OST118405 (lexicon)
OST78675 (lexicon) OST41506 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21173
Vector Insertion
Chr 11: 100235514 - 100235639
Public Clones not available
Private Clones OST339452 (lexicon) OST230715 (lexicon) OST205499 (lexicon) OST193703 (lexicon)
OST142279 (lexicon) OST108475 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13632
Vector Insertion
Chr 11: 100234010 - 100235391
Public Clones CMHD-GT_264C10-3 (cmhd) PST19015-NR (escells) PST19058-NR (escells) IST14901E11 (tigm)
IST13062C11 (tigm)
Private Clones OST282258 (lexicon) OST211281 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20423
Vector Insertion
Chr 11: 100233776 - 100233969
Public Clones not available
Private Clones OST363867 (lexicon) OST208769 (lexicon) OST167409 (lexicon) OST158779 (lexicon)
OST146041 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000001592
Sequence
GAGTTGCTGCCTTGGCCAGAGTCCGGAGCAGCCGCCGCCCGAGTGCGCCGAGCTCAGTTCGCTGCCCGCGCCGGCTCCCTCCCGGCCAGACCCGACCCCG

ATTCGGCTCAGCCCGGCTCCACGCTCAG - UNI20080 - - UNI29544 - CAGCCACCATGGAGGTGATGAACCTTATTGAGCAGCCCATCAAGG

TGACAGAGTGGCAACAGACATACACCTACGACTCGGGCATCCACTCCGGCGTCAATACCTGTGTGCCCTCTGTAAGCAGCAAGGGCATCATGGATGAGGA

TGATGCCTGCGGCAGACAGTACACACTCAAGAAGACTACCACCTATACACAAGGGGTGCCACAGAACCAAG - UNI19549 - - UNI25850 - - 

UNI29544 - GTGACCTGGAATACCAGATGTCCACAACGGCCAGAGCCAAGCGGGTGCGGGAGGCCATGTGTCCAGGGGTCTCAGGCGAGGACAGTTCT

CTACTGCTGGCCACCCAGGTGGAGGGGCAGACAACCAATCTGCAGCGCCTGGCCGAACCATCCCAGTTGCTCAAGTCGGCCATCGTCCATCTCATCAACT

ACCAGGATGATGCAGAGCTGGCCACCCGGGCTCTGCCTGAGCTCACCAAGCTGCTCAACGATGAGGACCCG GTAGTGGTGACCAAGGCGGCTATGATCG

TGAACCAGCTGTCCAAGAAGGAGGCATCCCGCCGGGCTCTAATGGGCTCGCCCCAGCTGGTGGCGGCGGTGGTGCGGACTATGCAGAACACCAGTGACCT

GGATACTGCCCGGTGTACCACCAGCATCCTGCACAACCTCTCTCACCACCGAGAGGGCTTGCTCGCCATATTCAAGTCTGGAGGCATCCCTGCCCTAGTC

CGAATGCTCAG TTCCCCCGTAGAATCTGTCCTGTTCTACGCCATCACCACACTGCACAACCTGCTGCTCTATCAGGAGGGCGCCAAGATGGCGGTGCGT

CTGGCAGACGGGCTGCAGAAGATGGTGCCCCTACTCAACAAGAACAACCCTAAGTTCCTGGCCATCACTACTGACTGCCTGCAGCTCCTGGCCTATGGCA

ACCAGGAGAGCAAG CTGATCATCCTGGCCAATGGGGGACCCCAAGGGCTTGTGCAGATCATGAGGAACTACAGCTACGAGAAGCTTCTGTGGACCACCA

GCCGTGTGCTCAAGGTGCTCTCCGTGTGTCCTAGCAACAAGCCCGCCATCGTGGAGGCTG - UNI33428 - GTGGGATGCAGGCTCTGGGCAAGCAC

TTGACAAGCAACAGTCCCCGCCTGGTGCAGAACTGCCTGTGGACTCTGCGCAATCTCTCGGATGTAGCCACCAAGCAG - UNI33428 - GAGGGCCT

GGAGAGTGTGCTGAAGATCCTGGTCAACCAACTGAGTGTAGATGACGTCAACGTCCTCACCTGTGCCACGGGCACCCTCTCCAACCTGACCTGCAACAAC

AGCAAAAACAAGACGCTGGTGACACAGAACAGTGGCGTGGAGGCGCTCATCCACGCCATCCTGAGAGCCGGAGACAAAGATGACATCACAGAGCCCGCTG

TCTGTGCCCTGCGCCACCTTACCAGCCGTCACCCCGAGGCTGAGATGGCCCAGAACTCTGTGCGCCTCAACTATGGAATCCCGGCCATTGTGAAACTGCT

CAACCAGCCAAACCAGTGGCCACTGGTCAAG - UNI12938 - - UNI33428 - GCAACTATTGGCCTGATCCGGAACCTGGCTCTGTGCCCAGCC

AACCATGCCCCTCTGCAGGAGGCCGCGGTCATTCCCCGCCTCGTCCAGCTGTTGGTCAAGGCCCACCAGGACGCCCAGCGCCATGTGGCTGCAGGCACCC

AGCAGCCCTACACGGATGGTGTGAGGATGGAGGAGATCGTGGAAGGCTGCACCGGAGCCCTGCACATCCTCGCCCGGGATCCCATGAACCGCATGGAGAT

CTTCCGGCTCAACACCATTCCCCTGTTTGTCCAG - UNI2261 - CTCCTGTACTCCTCTGTGGAGAACATCCAGCGTGTGGCTGCGGGAGTGCTCTG

CGAGCTGGCCCAGGACAAGGAGGCTGCCGACGCCATTGATGCGGAGGGCGCCTCTGCCCCTCTCATGGAGCTACTCCATTCCCGCAATGAGGGCACCG -

 UNI21173 - CGACCTACGCTGCTGCTGTCCTGTTCCGCATCTCTGAGGACAAGAACCCAGATTACCGTAAGCGAGTGTCTGTGGAGCTCACCAATTC

CCTCTTCAAGCATGACCCAGCTGCCTGGGAGGCT - UNI13632 - GCCCAGAGTATGATCCCGATCAACGAACCCTATGCAGACG - UNI20423 

- ACATGGATGCCACCTACCGCCCCATGTACTCCAGCGATGTGCCTCTGGACCCTCTGGACATGCACATGGACCTGGATGGAGACTACCCCATGGACACC

TACAGTGACGGCCTGAGGCCTCCCTACCCCACTGCAGACCACATGCTGGCCTAGCCAGCTCCACCTCA GCGCTGTTTCTCACCTGGAAAGCTCTCAAGA

GCAGACTGTGGGAGGAGACAGAAAAGTACCTGAGCCCCGGGGGCCGGCCTGGACTTCCTGCTGAACACGCGTGCTCCCGTGCTCCAGAGAGTTCCTCCAT

AGGGATTTTGGGATGGTGTCTGTTCCTGCTTTTCTGTCCTGGGCTGGGGATCCAGGCTCAGCACTTTCTCCCCGTCCCCACTATGGCTATGGCCACTAAA

GCTTTAGACTCAGCCTGTGTCCCTGCACAGCAATTCTCTCTGCTGACTCCAGCTGCCTGGACCCCCACCCCCACCCCCACCCAGGCCTTCCTTTGTTTTT

TTTCGGGGGCCAGTTTTCTCACTTGACCTCCTGGGATATCCAAGACACAGGTTCAAGGCCCCAACCCCTGACACCCAAAGCTTCTTTTGAAAAGTTCAGG

GACCTTCTTGGGGGTCGGTGGGGAGAGCGGAGACATTAAGTGCCCCTGCCAGGACCTGCCCTTCCCTTCAGGATGCTAAGTTTTTGCTTTGACCCTCCCA

AGGGGGGAGCTCTTGGTGACGCTCCCTCCCTCTCACATCACTCCACACTGGCCCATCTGCTCTGCAGAAGCGTTCTGGCTCACCCCTCTGGTGTGTGGTG

AGGGGCTTTCTTCTCCCCCTCCTGTTTGACTCCCACCACCTCCTGCACATGGGTTTGGGGGCGGGGGTGGGGGACTGAAAGGGAAGTCCCCTCAGAGAGT

CTTATTATCAACACTTTATTTTTTGGTTATTGGCTTTTCTTTTCTTTTTTTGTTTTTGTATAGACCAAAGCAAAGAAAATAAAATAACACAGAGATCC
Translation
 - UNI20080 - - UNI29544 - MEVMNLIEQPIKVTEWQQTYTYDSGIHSGVNTCVPSVSSKGIMDEDDACGRQYTLKKTTTYTQGVPQNQG - 

UNI19549 - - UNI25850 - - UNI29544 - GDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQTTNLQRLAEPSQLLKSAIVHLIN

YQDDAELATRALPELTKLLNDEDP VVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPAL

VRMLS SSPVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESK LIILANGGPQGLVQIMRNYSYEKLL

WTTSRVLKVLSVCPSNKPAIVEAG - UNI33428 - GGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQ - UNI33428 - EGLESVLKILVNQ

LSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVK

 - UNI12938 - - UNI33428 - ATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILAR

DPMNRMEIFRLNTIPLFVQ - UNI2261 - LLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTA - UNI21173 - ATY

AAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEA - UNI13632 - AQSMIPINEPYADD - UNI20423 - DMDATYRPMYSSDVPLDPLD

MHMDLDGDYPMDTYSDGLRPPYPTADHMLA 
Transcript ENSMUST00000107403
Sequence
GCCAGAGTCCGGAGCAGCCGCCGCCCGAGTGCGCCGAGCTCAGTTCGCTGCCCGCGCCGGCTCCCTCCCGGCCAGACCCGACCCCGATTCGGCTCAGCCC

GGCTCCACGCTCAGGTACACCCGATCGGG - UNI19549 - - UNI29544 - CCACCATGGAGGTGATGAACCTTATTGAGCAGCCCATCAAGGTG

ACAGAGTGGCAACAGACATACACCTACGACTCGGGCATCCACTCCGGCGTCAATACCTGTGTGCCCTCTGTAAGCAGCAAGGGCATCATGGATGAGGATG

ATGCCTGCGGCAGACAGTACACACTCAAGAAGACTACCACCTATACACAAGGGGTGCCACAGAACCAAG - UNI19549 - - UNI25850 - - UN

I29544 - GTGACCTGGAATACCAGATGTCCACAACGGCCAGAGCCAAGCGGGTGCGGGAGGCCATGTGTCCAGGGGTCTCAGGCGAGGACAGTTCTCT

ACTGCTGGCCACCCAGGTGGAGGGGCAGACAACCAATCTGCAGCGCCTGGCCGAACCATCCCAGTTGCTCAAGTCGGCCATCGTCCATCTCATCAACTAC

CAGGATGATGCAGAGCTGGCCACCCGGGCTCTGCCTGAGCTCACCAAGCTGCTCAACGATGAGGACCCG GTAGTGGTGACCAAGGCGGCTATGATCGTG

AACCAGCTGTCCAAGAAGGAGGCATCCCGCCGGGCTCTAATGGGCTCGCCCCAGCTGGTGGCGGCGGTGGTGCGGACTATGCAGAACACCAGTGACCTGG

ATACTGCCCGGTGTACCACCAGCATCCTGCACAACCTCTCTCACCACCGAGAGGGCTTGCTCGCCATATTCAAGTCTGGAGGCATCCCTGCCCTAGTCCG

AATGCTCAG TTCCCCCGTAGAATCTGTCCTGTTCTACGCCATCACCACACTGCACAACCTGCTGCTCTATCAGGAGGGCGCCAAGATGGCGGTGCGTCT

GGCAGACGGGCTGCAGAAGATGGTGCCCCTACTCAACAAGAACAACCCTAAGTTCCTGGCCATCACTACTGACTGCCTGCAGCTCCTGGCCTATGGCAAC

CAGGAGAGCAAG CTGATCATCCTGGCCAATGGGGGACCCCAAGGGCTTGTGCAGATCATGAGGAACTACAGCTACGAGAAGCTTCTGTGGACCACCAGC

CGTGTGCTCAAGGTGCTCTCCGTGTGTCCTAGCAACAAGCCCGCCATCGTGGAGGCTG - UNI33428 - GTGGGATGCAGGCTCTGGGCAAGCACTT

GACAAGCAACAGTCCCCGCCTGGTGCAGAACTGCCTGTGGACTCTGCGCAATCTCTCGGATGTAGCCACCAAGCAG - UNI33428 - GAGGGCCTGG

AGAGTGTGCTGAAGATCCTGGTCAACCAACTGAGTGTAGATGACGTCAACGTCCTCACCTGTGCCACGGGCACCCTCTCCAACCTGACCTGCAACAACAG

CAAAAACAAGACGCTGGTGACACAGAACAGTGGCGTGGAGGCGCTCATCCACGCCATCCTGAGAGCCGGAGACAAAGATGACATCACAGAGCCCGCTGTC

TGTGCCCTGCGCCACCTTACCAGCCGTCACCCCGAGGCTGAGATGGCCCAGAACTCTGTGCGCCTCAACTATGGAATCCCGGCCATTGTGAAACTGCTCA

ACCAGCCAAACCAGTGGCCACTGGTCAAG - UNI12938 - - UNI33428 - GCAACTATTGGCCTGATCCGGAACCTGGCTCTGTGCCCAGCCAA

CCATGCCCCTCTGCAGGAGGCCGCGGTCATTCCCCGCCTCGTCCAGCTGTTGGTCAAGGCCCACCAGGACGCCCAGCGCCATGTGGCTGCAGGCACCCAG

CAGCCCTACACGGATGGTGTGAGGATGGAGGAGATCGTGGAAGGCTGCACCGGAGCCCTGCACATCCTCGCCCGGGATCCCATGAACCGCATGGAGATCT

TCCGGCTCAACACCATTCCCCTGTTTGTCCAG - UNI2261 - CTCCTGTACTCCTCTGTGGAGAACATCCAGCGTGTGGCTGCGGGAGTGCTCTGCG

AGCTGGCCCAGGACAAGGAGGCTGCCGACGCCATTGATGCGGAGGGCGCCTCTGCCCCTCTCATGGAGCTACTCCATTCCCGCAATGAGGGCACCG - U

NI21173 - CGACCTACGCTGCTGCTGTCCTGTTCCGCATCTCTGAGGACAAGAACCCAGATTACCGTAAGCGAGTGTCTGTGGAGCTCACCAATTCCC

TCTTCAAGCATGACCCAGCTGCCTGGGAGGCT - UNI13632 - GCCCAGAGTATGATCCCGATCAACGAACCCTATGCAGACG - UNI20423 - 

ACATGGATGCCACCTACCGCCCCATGTACTCCAGCGATGTGCCTCTGGACCCTCTGGACATGCACATGGACCTGGATGGAGACTACCCCATGGACACCTA

CAGTGACGGCCTGAGGCCTCCCTACCCCACTGCAGACCACATGCTGGCCTAGCCAGCTCCACCTCA
Translation
 - UNI19549 - - UNI29544 - MEVMNLIEQPIKVTEWQQTYTYDSGIHSGVNTCVPSVSSKGIMDEDDACGRQYTLKKTTTYTQGVPQNQG - 

UNI19549 - - UNI25850 - - UNI29544 - GDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQTTNLQRLAEPSQLLKSAIVHLIN

YQDDAELATRALPELTKLLNDEDP VVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPAL

VRMLS SSPVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESK LIILANGGPQGLVQIMRNYSYEKLL

WTTSRVLKVLSVCPSNKPAIVEAG - UNI33428 - GGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQ - UNI33428 - EGLESVLKILVNQ

LSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVK

 - UNI12938 - - UNI33428 - ATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILAR

DPMNRMEIFRLNTIPLFVQ - UNI2261 - LLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTA - UNI21173 - ATY

AAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEA - UNI13632 - AQSMIPINEPYADD - UNI20423 - DMDATYRPMYSSDVPLDPLD

MHMDLDGDYPMDTYSDGLRPPYPTADHMLA

For any suggestions or comments, please send an email to unitrap@crg.es