Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001576 (Ergic1)
Chromosomal location
Chr 17: 26698471 - 26792295 (+)
Description
endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1 Gene [Source:MGI Symbol;Acc:MGI:1914708]
RefSeq_dna
NM_026170 
RefSeq_peptide
NP_080446.1 
MGI
MGI:1914708 
Uniprot/SWISSPROT
Q9DC16 
Uniprot/SPTREMBL
Q4FK22 Q69ZP5 
Human Ortholog
ENSG00000113719 (ERGIC1)
Omim not available
UniTrap UNI1463
Vector Insertion
Chr 17: 26698578 - 26745537
Public Clones (sanger) CD0466 (sanger) E044E06 (ggtc) D119G05 (ggtc) D124H04 (ggtc)
D057D03 (ggtc) Q012E03 (ggtc) IST14297G2 (tigm) IST14155C10 (tigm)
IST14217F1 (tigm) IST14139G10 (tigm) IST14233H2 (tigm) IST14656D4 (tigm)
IST14572H10 (tigm) IST14168E2 (tigm) IST14783D4 (tigm) IST14225F1 (tigm)
IST14612G12 (tigm)
Private Clones OST315279 (lexicon) OST226652 (lexicon) OST214740 (lexicon) OST130720 (lexicon)
OST114775 (lexicon) OST52413 (lexicon) OST33136 (lexicon) OST32669 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI713
Vector Insertion
Chr 17: 26745600 - 26751300
Public Clones DB0141 (sanger)
Private Clones OST349268 (lexicon) OST199844 (lexicon) OST123508 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10300
Vector Insertion
Chr 17: 26761630 - 26766499
Public Clones KST011 (baygenomics) KST018 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24104
Vector Insertion
Chr 17: 26772992 - 26775687
Public Clones not available
Private Clones OST234603 (lexicon) OST233435 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000001619
Sequence
GGCCGAGGAGGCGTTGGCAGCGGGCTCGGACCCACGCGGCGCTGCGGCCCGCCTGGCCTGCAACGCTCCCACCGGCTCGGCGGCACGATGCCCTTTGACT

TCAGGAG - UNI1463 - GTTTGACATCTACAGGAAGGTGCCCAAGGACCTCACACAGCCGACATATACTGGTGCCATTA - UNI713 - TCTCCA

TCTGCTGCTGCCTCTTCATCCTCTTCCTCTTCCTGTCGGAGCTCACTGGATTCATCACAACAGAAGT GGTGAATGAGCTCTACGTCGATGACCCAGACA

AGGACAGCGGAGGCAAAATTGACGTCAGTCTCAACATCAGTTTACCCAATTTGCACTGTGAAT - UNI10300 - TGGTCGGGCTTGACATCCAAGAT

GAGATGGGCAGACACGAAGTGGGCCACATCGACAATTCCATGAAGATCCCGCTGAATAATGGAGCCGGCTGCCGCTTCGAGGGCCAGTTCAGCATCAACA

AG GTTCCCGGCAACTTCCATGTGTCCACACACAGTGCCACAGCGCAGCCACAGAACCCGGACATGACACATACCATCCATAAACTCTCCTTTGGGGATA

CGCTACAG GTCCAGAATGTTCACGGGGCTTTCAATGCTCTTGGGGGAGCAGACAGACTCACCTCCAACC - UNI24104 - CCCTGGCCTCCCATGA

CTACATCTTGAAGATTGTACCCACAGTGTATGAGGACAAGAGCGGCAAGCAGCGCTACTCCTACCAGTACACAGTGGCCAACAAG GAGTACGTTGCCTA

CAGCCACACGGGACGCATTATCCCTGCCATCTGGTTCCGCTATGACCTCAGCCCCATCACAGTCAAGTACACAGAGAGAAGACAACCCCTGTACAGGTTC

ATCACCACA ATCTGTGCCATCATCGGCGGAACCTTCACTGTCGCCGGCATTCTGGACTCCTGTATCTTCACAGCCTCAGAAGCGTGGAAGAAGATCCAG

CTGGGCAAAATTCACTGACGTCCTGTCCAGCCCAGTGACTGAGGACCAGGAACCCTGCTAGCCCTGCCTCTGGCGTCCTATCTCCTTCTGCCTTCTCTGG

CCCAGTGTGTGTGGGAGGAGGGTGATGGTTATGGGTGGCACCAGGTTCCCCAGCTACCTCTCTCCCCATGTTTTAGATAAATTAACACTGCCTG
Translation
MPFDFRR - UNI1463 - RFDIYRKVPKDLTQPTYTGAII - UNI713 - ISICCCLFILFLFLSELTGFITTEV VVNELYVDDPDKDSGGKIDV

SLNISLPNLHCEL - UNI10300 - LVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINK VPGNFHVSTHSATAQPQNPDMTHTIHKLSF

GDTLQ VQNVHGAFNALGGADRLTSNP - UNI24104 - PLASHDYILKIVPTVYEDKSGKQRYSYQYTVANK EYVAYSHTGRIIPAIWFRYDLSPI

TVKYTERRQPLYRFITT ICAIIGGTFTVAGILDSCIFTASEAWKKIQLGKIH

For any suggestions or comments, please send an email to unitrap@crg.es