Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001630 (Stk38l)
Chromosomal location
Chr 6: 146673530 - 146727324 (+)
Description
serine/threonine kinase 38 like Gene [Source:MGI (curated);Acc:Stk38l-001]
RefSeq_dna
NM_172734 
RefSeq_peptide
NP_766322.1 
UniGene
Mm.322121 Mm.401272 Mm.411977 Mm.418640 Mm.463326 Mm.463870 
MGI
MGI:1922250 
Uniprot/SWISSPROT
Q7TSE6 
Uniprot/SPTREMBL
B2KFR4 B2KFR5 
Human Ortholog
ENSG00000211455 (STK38L)
Omim not available
UniTrap UNI8144
Vector Insertion
Chr 6: 146673570 - 146706982
Public Clones (sanger) RRG406 (baygenomics) IST14247B9 (tigm)
Private Clones OST55251 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3272
Vector Insertion
Chr 6: 146717010 - 146717355
Public Clones AH0101 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7238
Vector Insertion
Chr 6: 146717679 - 146720103
Public Clones RRT116 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000001675
Sequence
ACTGAGGAGGAGGCTGAGCGGGCGCGGGCGACACCGGCAG - UNI8144 - TTCCAGTTACTATGGCAATGACGGCAGGGGCAACAACTACCTTTCCT

ATGAGCAACCATACCCGGGAAAGAGTAACTGTGGCCAAGCTCACACTGGAGAATTTTTACAGCAACCTAATTTTACAGCATGAAGAGAGAGAAACCAG G

CAGAAGAAGTTAGAAGTGGCTATGGAAGAAGAAGGATTGGCAGATGAGGAG AAAAAGTTACGTCGATCGCAGCATGCTCGTAAAGAAACAGAGTTCTTA

CGCCTTAAGAGGACCAGACTTGGCCTAGATGACTTTGAGTCTCTGAAGGTTATAGGAAGAGGAGCTTTCGGAGAG GTGCGGCTGGTCCAGAAGAAAGAC

ACGGGGCACATCTATGCCATGAAGATCCTGAGGAAAGCTGACATGCTTGAGAAAGAGCAG GTGGCTCATATCCGAGCAGAAAGGGACATTTTGGTGGAA

GCAGATGGAGCCTGGGTGGTGAAGATGTTCTACAGTTTTCAGGACAAACGGAATCTCTATCTCATCATGGAATTTCTTCCTGGAG GTGACATGATGACA

TTGCTGATGAAGAAGGACACCTTAACAGAAGAAGAGACACAGTTCTACATCTCAGAGACTGTCTTGGCGATAGATGCAATTCACCAGCTGGGCTTCATCC

ACCGGGACGTCAAACCAGACAACCTTTTACTGGATGCCAAG - UNI3272 - GGACATGTAAAATTATCTGATTTTGGTTTGTGCACGGGGTTAAAGA

AAGCTCACAGGACTGAATTCTACAGAAACCTCACACATAACCCGCCAAGCGACTTCT CATTTCAGAACATGAATTCAAAGCGGAAAGCAGAGACATGGA

AGAAGAACAGGAGACAGCTG - UNI7238 - GCTTACTCCACAGTTGGAACACCAGACTACATTGCTCCAGAAGTATTCATGCAGACTGGCTACAACA

AATTGTGTGACTGGTGGTCCTTGGGAGTGATTATGTACGAGATGCTAATAG GCTTTCCACCTTTCTGCTCTGAAACACCACAAGAAACATACAGAAAAG

TTATGAGCTGGAAGGAGACTCTGGCATTTCCTCCGGAAGTGCCCGTCTCTGAGAAAGCCAAGGACTTGATTCTCAG ATTTTGTACTGATTCTGAAAACA

GAATTGGGAATGGTGGTGTGGAAGAAATCAAAGGTCATCCGTTCTTTGAGGGTGTAGACTGGGGGCACATAAG GGAAAGACCAGCAGCTATTCCTATAG

AAATCCGGAGTATAGATGACACCTCAAACTTTGATGACTTCCCTGAGTCTGATATCTTACAGCCAG TGCCGAATACCACAGAGCCCGACTACAAATCCA

AAGACTGGGTTTTTCTCAATTACACCTACAAAAGGTTTGAAGGGCTGACCCAGAGAGGCTCCATTCCTACATACATGAAAGCTGGGAAGTTATGATGATC

ACAGTCGCCCATAGCCAGGAGAACTCAGGTAGCTGCATCCGCAGGCTGGCTCGGCATCAGCACCAGGAGCTCTGGGACAGTGCTGCTCTCCAGCCAGAGG

AACGACTACAGCTTGGGAATCTGAGGCTGCTATGGCTATGGGAATTGCTCAGCTTTTTTTTTTCTTTTTCTTTTTTTTTGTATTAACTTTATTATACAAA

GGTACTGGAACAAAAGAAACAGACATTCCCTCCTAACTGCACTGCCTACGTGCATGTTGAGAGGTCCATCCTGCCCATGTGCTGCGCTTCCGATTGCAAC

ACTAATCCAGCCAGAACTGCATTGCACTGACGGCACCATGACAGCCTGAGGTTGCTCTCAGTGTCCCTGCTTCACTGCAGAGCCCGTGGGTCTAGAATCA

GTGAAAAGCCATCTTCTGTAGCTGCTGTTAGTAGAACATTTGCCCTGTTGGTTTGGACATTGTGGGCTCTACATGAAGACAGTTTCTGTACCGGCTCCAA

GGAACTTAAGGACGCTGACTTCAACGACATTAGAATTTCCTGTCAGGCTCTCACGCAGACCCTGTGATAGGGAAGATGAGCTTCTGTTAGGGTGAGGGCA

TTTCTCACCTTCGCTCCGGCATCTCCAAGGCTGACGGTGCTGAGAGATTGTGACTTGACGACTGATGTGCACACATGGAGATGGACCTGAATGATTGTCA

GCTACTCACTTTTAACAATGCTGTAGCATTGTTTTAGTTTGAGGATGGTGAGCTGAGTTTCAGAAATGACCATGAAAGCTGCTTGTAGAACCTAGTATGT

TTTTATTAAACTATTTTTTTTAATGTCAAACTTCTGATCAGTCAATGGACACTGTGGAGAGCAGAGTGTGGCTCACTGTGGCTTTCTGCAGAGGTGGTAC

TTGTCCAGCTGGTGACCCTTTGTTCCCTTGATTGCACTAGTGCCATTGTTTTCCAATGAACCAAAGATCCTGAACAGTGGCTGTCAGCAGGGAGTGGAGC

TCCGGCTTTACAGGGGAGCTGCGCTCCCTTGACAGAGGCCAGCCCTGTTCACTGTTAGCTCATCACTGTGGTTAAAGCCCATTATGAAATACAGGAAGTG

GGTGCTGGCTGGGAGGGTGTGACTGGAGACTGGGCAGAAAAGTCAGCATCAGATTCTTGGGGTGTTTCCCTAAGGATTACATCATCTTTTCTTGCTTAGC

ATTTTGATTCTGAAACAACTTTCTGAGGAGATGTAGTTTTGTGAGTTGTAGTTGTAGTAACTTCTCAGGGAATGGCTAATGTTTATCATCTATGATTGAT

ATAGTGAGACTTTATGGGAGGAATGCTTCTCCTGAGGGCACTGAGCAATGCCTTGTGACCCCTCTTTCATCAAGGCCATCAGCTCCTGATTTATTTTGGT

GAGTCCTTTAAGGCCCCCCCCATTTTGCTGTTGAGTCTGGTAATCAACACCACTTGTTATCTACTGGCTCAGCTGTAGCCTGATCAATCCTATGCCAAGT

ATTTGGAGAAAGCACTGAAAATGGTAGATAAGCCTCCCTGACTTTAGCTGCCTTAATATCTGCAGGGTATATGAGCTTCTCCAAGTAGTCTGTCTCAAGG

GTACTTAAGCAGCAGAGACCCCTGAATATAGGGATTCTACCTTTTCTTTTAGAATGGGACTTTTCTAGTGTGAGTGTCTAGGTTGGATAGGAGACCTTGC

CAAATTCTCTAGCTCAGGTGTGATAACTACCTAACTATCGTAGGGTGGGTGTTGTCAATCCAGGTAACTGGGGTAGTTTGAGATTAGTGTACAGGAGAAT

TACCAAACTTATGTTTCCATGATGTAGGGACAGAGCACTTTGTCTGATCTCTCTGTTGTGGTTGTAAAAGCTGTGAGAGGCAGGTTTCCTGGTGGTGGAG

AGGCATTTTGGGAAGTTTGCTTTGCAGCATTAACATGGCTGCCCACTTTTCAGGAATTTCTTGTGGAAGCGTTCCCTAAGCTAGTGTAAGGCCCCTAAAG

ACTGTCTGCCTGTTGAAGCAAAAATACGAGGCATGGTGCAAATTGTGCAAATAATTTGCAGAGATCCTCTGATACTGACTTTTTCCCATTATACACTTCC

CATATTTTAGGTAAATAATGTAATTTAAGTGATAAAACCCTATCTTAATCAACTGGGCATAGTGACATTTTCTCTTAATCTCTATTTTGAGTCTAGGAAG

TTTTATTATAAACGGTGGTTTGGGTTTTTCTAAAGATACAGAAAATGTGTATAATCCAGATGTATTGGTTTCCTGATTGAGTAGAGACTTGTACTTTTTC

ATTAAAACCTTTGTGTTGAAGCAGTTGTTCACAGCTAAGTCTGGAGATGTATGAAACCTGGGCTGTCCAAAGTAAGTTGTGACCACTTAACCACCGATCA

GCTGTGTGGTGAAAGTGCCAGCTATGGAATATTAAATGCGTTCTTTGGCTGCTAAGGCTTAAGATAGGGCTCCTTTATTTCCGTATCAGCATAGCTCTTA

AACACATGCATAGCTCTGTACAAGCTGTACATTTTAAAATATCTTGAAGCACAGTTTGTTTTGGTGTTGAGAATCTAGTCCACCAGTCAGTCTCTGACAG

CAGGAGAGATAGCTAGCCACCTACCTATCTTTTGGCAGTCTACAAGTAAGTTACTTGAGGGTCAGAAAAGGGTCCTGGCACATCCTCTCTTTGAATTGTT

AAAATTTGGAAAATTCAAAAGCAACTGTTTTGCTATGATCATGATTATTTCTCATTTTATTTCAAAATTATTTTCTCTGTAGAAGTGCACTTATTTCTGA

AAAATCTTAAGCCAACACTTAATAAATATGAGACACTTGAGACTACTAGAAATATTTTAGATTTTTATTACAAAATGTGAGGAGATGAAGGAATAAAGTA

ATAGAAGTGTATTGTAGTTTTTGGGGGGGTTTTGTTTGTTTTTTTTTTTAAGCAATATAATCCAGCAGTTGTCCAGAACCATCAGGCTTCTGAGCCCATC

CAGCGTTTCGAAGACTGTTGGGCAGGGGCATTGAGGGCCTCTTCATTCACGGCACAACGAGAATAAAGCCACGTTT
Translation
 - UNI8144 - MAMTAGATTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETR RQKKLEVAMEEEGLADEE KKLRRSQHARKETEFLRLKRTR

LGLDDFESLKVIGRGAFGE VRLVQKKDTGHIYAMKILRKADMLEKEQ VAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGG GDMMTLLM

KKDTLTEEETQFYISETVLAIDAIHQLGFIHRDVKPDNLLLDAK - UNI3272 - GHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFS SFQNMNS

KRKAETWKKNRRQL - UNI7238 - AYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIG GFPPFCSETPQETYRKVMSWKETLAFPPEVPV

SEKAKDLILR RFCTDSENRIGNGGVEEIKGHPFFEGVDWGHIR RERPAAIPIEIRSIDDTSNFDDFPESDILQPV VPNTTEPDYKSKDWVFLNYTYK

RFEGLTQRGSIPTYMKAGKL
Transcript ENSMUST00000111644
Sequence
CGACACCGGCAG - UNI8144 - TTCCAGTTACTATGGCAATGACGGCAGGGGCAACAACTACCTTTCCTATGAGCAACCATACCCGGGAAAGAGTAA

CTGTGGCCAAGCTCACACTGGAGAATTTTTACAGCAACCTAATTTTACAGCATGAAGAGAGAGAAACCAG GCAGAAGAAGTTAGAAGTGGCTATGGAAG

AAGAAGGATTGGCAGATGAGGAG AAAAAGTTACGTCGATCGCAGCATGCTCGTAAAGAAACAGAGTTCTTACGCCTTAAGAGGACCAGACTTGGCCTAG

ATGACTTTGAGTCTCTGAAGGTTATAGGAAGAGGAGCTTTCGGAGAG GTGCGGCTGGTCCAGAAGAAAGACACGGGGCACATCTATGCCATGAAGATCC

TGAGGAAAGCTGACATGCTTGAGAAAGAGCAG GTGGCTCATATCCGAGCAGAAAGGGACATTTTGGTGGAAGCAGATGGAGCCTGGGTGGTGAAGATGT

TCTACAGTTTTCAGGACAAACGGAATCTCTATCTCATCATGGAATTTCTTCCTGGAG GTGACATGATGACATTGCTGATGAAGAAGGACACCTTAACAG

AAGAAGAGACACAGTTCTACATCTCAGAGACTGTCTTGGCGATAGATGCAATTCACCAGCTGGGCTTCATCCACCGGGACGTCAAACCAGACAACCTTTT

ACTGGATGCCAAG - UNI3272 - GGACATGTAAAATTATCTGATTTTGGTTTGTGCACGGGGTTAAAGAAAGCTCACAGGACTGAATTCTACAGAAA

CCTCACACATAACCCGCCAAGCGACTTCT CATTTCAGAACATGAATTCAAAGCGGAAAGCAGAGACATGGAAGAAGAACAGGAGACAGCTG - UNI72

38 - GCTTACTCCACAGTTGGAACACCAGACTACATTGCTCCAGAAGTATTCATGCAGACTGGCTACAACAAATTGTGTGACTGGTGGTCCTTGGGAGT

GATTATGTACGAGATGCTAATAG GCTTTCCACCTTTCTGCTCTGAAACACCACAAGAAACATACAGAAAAGTTATGAGCTGGAAGGAGACTCTGGCATT

TCCTCCGGAAGTGCCCGTCTCTGAGAAAGCCAAGGACTTGATTCTCAG ATTTTGTACTGATTCTGAAAACAGAATTGGGAATGGTGGTGTGGAAGAAAT

CAAAGGTCATCCGTTCTTTGAGGGTGTAGACTGGGGGCACATAAG GGAAAGACCAGCAGCTATTCCTATAGAAATCCGGAGTATAGATGACACCTCAAA

CTTTGATGACTTCCCTGAGTCTGATATCTTACAGCCAG TTGCCTTTTTTCTCTTTCTAGTGCCGAATACCACAGAGCCCGACTACAAATCCAAAGACTG

GGTTTTTCTCAATTACACCTACAAAAGGTTTGAAGGGCTGACCCAGAGAGGCTCCATTCCTACATACATGAAAGCTGGGAAGTTATGATGATCACAGTCG

CCCATAGCCAGGAGAACTCAGGTAGCTGCATCCGCAGGCTGGCTCGGCATCAGCACCAGGAGCTCTGGGACAGTGCTGCTCTCCAGCCAGAGGAACGACT

ACAGCTTGGGAATCTGAGGCTGCTATGGCTATGGGAATTGCTCAGCTTTTTTTTTTCTTTTTCTTTTTTTTTGTATTAACTTTATTATACAAAGGTACTG

GAACAAAAGAAACAGACATTCCCTCCTAACTGCACTGCCTACGTGCATGTTGAGAGGTCCATCCTGCCCATGTGCTGCGCTTCCGATTGCAACACTAATC

CAGCCAGAACTGCATTGCACTGACGGCACCATGACAGCCTGAGGTTGCTCTCAGTGTCCCTGCTTCACTGCAGAGCCCGTGGGTCTAGAATCAGTGAAAA

GCCATCTTCTGTAGCTGCTGTTAGTAGAACATTTGCCCTGTTGGTTTGGACATTGTGGGCTCTACATGAAGACAGTTTCTGTACCGGCTCCAAGGAACTT

AAGGACGCTGACTTCAACGACATTAGAATTTCCTGTCAGGCTCTCACGCAGACCCTGTGATAGGGAAGATGAGCTTCTGTTAGGGTGAGGGCATTTCTCA

CCTTCGCTCCGGCATCTCCAAGGCTGACGGTGCTGAGAGATTGTGACTTGACGACTGATGTGCACACATGGAGATGGACCTGAATGATTGTCAGCTACTC

ACTTTTAACAATGCTGTAGCATTGTTTTAGTTTGAGGATGGTGAGCTGAGTTTCAGAAATGACCATGAAAGCTGCTTGTAGAACCTAGTATGTTTTTATT

AAACTATTTTTTTTAATGTCAAA
Translation
 - UNI8144 - MAMTAGATTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETR RQKKLEVAMEEEGLADEE KKLRRSQHARKETEFLRLKRTR

LGLDDFESLKVIGRGAFGE VRLVQKKDTGHIYAMKILRKADMLEKEQ VAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGG GDMMTLLM

KKDTLTEEETQFYISETVLAIDAIHQLGFIHRDVKPDNLLLDAK - UNI3272 - GHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFS SFQNMNS

KRKAETWKKNRRQL - UNI7238 - AYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIG GFPPFCSETPQETYRKVMSWKETLAFPPEVPV

SEKAKDLILR RFCTDSENRIGNGGVEEIKGHPFFEGVDWGHIR RERPAAIPIEIRSIDDTSNFDDFPESDILQPV VAFFLFLVPNTTEPDYKSKDWV

FLNYTYKRFEGLTQRGSIPTYMKAGKL

For any suggestions or comments, please send an email to unitrap@crg.es