Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001687 (Ubl3)
Chromosomal location
Chr 5: 149316239 - 149364041 (-)
Description
ubiquitin-like 3 Gene [Source:MGI Symbol;Acc:MGI:1344373]
RefSeq_dna
NM_011908 
RefSeq_peptide
NP_036038.1 
UniGene
Mm.21846 
MGI
MGI:1344373 
Uniprot/SWISSPROT
Q9Z2M6 
Uniprot/SPTREMBL
A4FTW0 Q3UYL1 
Human Ortholog
ENSG00000122042 (UBL3)
Omim not available
UniTrap UNI3005
Vector Insertion
Chr 5: 149323579 - 149363528
Public Clones XR0061 (sanger) AS1028 (sanger) BC0090 (sanger) (sanger)
AH0027 (sanger) AS0287 (sanger) BC0082 (sanger) AT0583 (sanger)
AH0039 (sanger) BC0074 (sanger) XB723 (baygenomics) RRS265 (baygenomics)
RRO050 (baygenomics) 3SD078G10 (ggtc) 5SE070G11 (ggtc) 5SD064A06 (ggtc)
3SE070G11 (ggtc) 5SD078G10 (ggtc) 3SD064A06 (ggtc) 3SE065F12 (ggtc)
FHCRC-GT-S1-8H1 (fhcrc) IST14375C3 (tigm) IST11564A7 (tigm)
Private Clones OST459778 (lexicon) OST452835 (lexicon) OST451254 (lexicon) OST448597 (lexicon)
OST446000 (lexicon) OST445419 (lexicon) OST426079 (lexicon) OST420636 (lexicon)
OST416925 (lexicon) OST413437 (lexicon) OST408927 (lexicon) OST394759 (lexicon)
OST374390 (lexicon) OST372910 (lexicon) OST352016 (lexicon) OST319645 (lexicon)
OST289001 (lexicon) OST276577 (lexicon) OST269623 (lexicon) OST237748 (lexicon)
OST212750 (lexicon) OST135282 (lexicon) OST134754 (lexicon) OST90613 (lexicon)
OST90610 (lexicon) OST89602 (lexicon) OST84426 (lexicon) OST84329 (lexicon)
OST71050 (lexicon) OST46463 (lexicon) OST41336 (lexicon) OST38549 (lexicon)
OST34737 (lexicon) OST30662 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3913
Vector Insertion
Chr 5: 149320932 - 149323469
Public Clones AT0900 (sanger) AS0721 (sanger) (sanger) AR0406 (sanger) AE0039 (sanger)
AS0576 (sanger) AP0575 (sanger) AS0278 (sanger) AS0109 (sanger)
AH0678 (sanger) CSH459 (baygenomics) D171C06 (ggtc) IST12846C8 (tigm)
IST14954D3 (tigm)
Private Clones OST461974 (lexicon) OST449632 (lexicon) OST413496 (lexicon) OST381033 (lexicon)
OST359982 (lexicon) OST349153 (lexicon) OST335242 (lexicon) OST301290 (lexicon)
OST182572 (lexicon) OST179821 (lexicon) OST177699 (lexicon) OST168457 (lexicon)
OST142873 (lexicon) OST102773 (lexicon) OST64177 (lexicon) OST45325 (lexicon)
OST43152 (lexicon) OST38863 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1312
Vector Insertion
Chr 5: 149318100 - 149320844
Public Clones DC0123 (sanger) CSH870 (baygenomics) D131F04 (ggtc) E132F04 (ggtc)
CMHD-GT_486D7-3 (cmhd)
Private Clones OST455414 (lexicon) OST324906 (lexicon) OST321772 (lexicon) OST272423 (lexicon)
OST127223 (lexicon) OST66229 (lexicon) OST55854 (lexicon) OST46079 (lexicon)
OST43113 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16361
Vector Insertion
Chr 5: 149317764 - 149318021
Public Clones (sanger)
Private Clones OST462381 (lexicon) OST317629 (lexicon) OST315364 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000079324
Sequence
GCGGCCCCGCGGCGCGCGCTGAGCTTCTCGGCGGCCCCGGCCGCTTTCAGCTCGGCGCTCGATGTGTAGCCACATAGTTATCTGTACACTTCGTCGCCGG

GGCTTTAATGAGGACCTGAGTCGCGAGCGCGTGTGAATCACCGCCTGGGCCGGGGAAAGAGGACGGCGCATTTAACCCCCTCCCACCCCGCTCCATGTCC

GTGTGTCACTCGGCTCTGTCCACCTGGCGCGGCGGGTCCTGGAGCTGCTACTGCTGCTGACGATCGGCTCCCCTCGCGCCTCTCGCCCCAGAAGCTCTTG

TGCTCCCACGTAACTTCTACTTTTTTTTTTAATTTTTATTTTTTTTTTCATTTTTGGGAAAAGCTCAGCACAAACCGATCAGAATTGTGAAGGTTCTTTT

TTATTTTTTCCGTAGTTCCAGCACTTCTGCTCTTGCTTTTTGTTTTGTTTTCTGCGTAAACCTCTGGCCCACTCTCAAAAGGCAAGATGTCCAGTCATGT

CCCGGCGGATATG - UNI3005 - ATTAATTTGCGCCTCATCTTGGTGAGTGGGAAGACGAAAGAGTTCCTCTTCTCCCCAAACGACTCTGCCTCTGA

CATCGCAAAGCACGTGTATGACAACTGGCCCATGG - UNI3913 - ACTGGGAAGAAGAGCAGGTCAGCAGCCCAAACATTCTTCGACTCATTTATCA

AGGCAGATTTCTACATGGAAACGTCACCCTAGGAG - UNI1312 - CATTAAAACTTCCTTTTGGCAAAACAACAGTGATGCATTTGGTGGCCAGAGA

GACCCTGCCAGAGCCCAACTCACAAG - UNI16361 - GTCAGAGAAATCGGGAGAAAACTGGTGAGAGCAACTGCTGTGTGATCCTGTAGCGTCGCC

AGCACAGATGTGGCAGTTTGTTGGCACTGCGGGGACAGAGGAGACTCAGCAGCTTCCAACACCTGTAGGACAGTCGCCAGCACATCCGTGGGACTGAATC

ACTCATGAACTCTGTCATCTCCTCTCACAAAGTAAAAAGAACCAAGAACACTTTCAGTGTGGTCCTTTATTCCTTATATCTGTGTGTGTGTTGAGCAGTC

TGAAGTGCACAGTGGTCCCCAGGGGACGCAGCAAGTCTCTCTGCAGACACCGGTGGCCCTGCTGCCGCAGAGACTCCTCCCTCCGCAGAAGTCTGAAGGC

AAGTGCTGCAAGTACAATTTGCACTAAAAATAATTATTATTTTCCTCATCACATAATCTGCACGTGTCTGTGGCGCCCAGTTCTCCTGTGTGTAGTCCAC

CCTGGAGGACACCAATCATCGGTGGAGTAAATACGAGGCTGGTCAGCCAGGGGGACAGGAAGGAATCTTACGTGCTGGGTGACTTCTACCAAAGTCGGCC

GCAGTGGCTGTCCTCACAGGATATCAAACTGGGCAAGACTGTTGTCACTGCAGCAAGTGAGAAGCCATGCCTGCTGCTCCCAGCGCTCTGTAGAGGGTGC

CCCTGCTGCCGGCCCACACCGAGGGGCGGCAGGATGACCCAAGCCTTAATGTGGAGGGGCCGTCACTGTGCAGAACTGGTGGGAAGCCTGAGTGGCAGAT

ATCAGAAGATCGGAAGCCTGCGCCATCACTCATCGAACCGTGCCGGGTTGCACTCATTCACTAGAGCAGAGGGATCTTTTAAAGTCTCCAGATGCTAATT

TTGTTACTTTCTGTAGTTTGCATTCGGAATCAGTGCTTGCAATTGTATTAAAATCACAAGCTGAGTTTTAAGGCATACATGATCAATAGCACCACTCTTA

TTTTTACCAATAATTTAAAGATTGATATGCTATAAATAAACAATTTGCACAGCACTAAAGCATGAGCTAATTTCATCTAAACCTGTAAAAAAAAAAAGAT

TTTATATTTTTTTTTCACTGGGAAGAAATCTTCCTGGATGAAATTACAAATATGTGTAGATTATATTTAATAAAAAAGACATAATAAAATATCTAACTGT

AGAACACAAATATAGATTGGCGTGTAGCATTATAAACCAGTATTCCATATCAATAACTTTATCCAGCCTTTTGAAAGATGAAGTTGCAGACTCCGTTGTG

TTCTGTATTTAACGAGGGCTCCTGGCCCTCTGCAGCATCAGATGTAAATGGTCTCTAAGGTCATCCTTGTTTCAATGCAATCAGGTTACTTTATTCATTG

TTAATGCTTTGAGGAAGGAAGAGGCTTTATATGCAGTAGATCTACGAAAATATTGTTCATACTGATCAGAATTAAATTTGTATAGAACAGAGTTTTAAAA

TGAATGTAAATAGCACTAAACCTTTTCTTTCTGCAGCCTGTCCTTAATAGATTTCTTCTGTAAAC
Translation
MSSHVPADM - UNI3005 - INLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMD - UNI3913 - DWEEEQVSSPNILRLIYQGRFLHGNVTL

GA - UNI1312 - ALKLPFGKTTVMHLVARETLPEPNSQG - UNI16361 - GQRNREKTGESNCCVIL

For any suggestions or comments, please send an email to unitrap@crg.es