Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001739 (Cldn15)
Chromosomal location
Chr 5: 137442486 - 137451728 (+)
Description
claudin 15 Gene [Source:MGI (curated);Acc:Cldn15-001]
RefSeq_dna
NM_021719 
RefSeq_peptide
NP_068365.1 
UniGene
Mm.87202 
MGI
MGI:1913103 
Uniprot/SWISSPROT
Q9Z0S5 
Human Ortholog
ENSG00000106404 (CLDN15)
Omim not available
UniTrap UNI27245
Vector Insertion
Chr 5: 137450393 - 137450479
Public Clones not available
Private Clones OST65813 (lexicon)
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000001790
Sequence
ATTCCTCTGACCTGCCAGGAAGCAGAGCCTCCCAGAGACCAGGCAGAGGCACTCAGACCTGACCTCCAGAAGACGGCAGACAAGAATCGCAGCTGGATGA

GCGCTCCTTCAGCCTTCTCCCTCCTCAGTCTTCCGTGACATCCCTTTTGGGCCAAAGCCCCCGGAATTCACCTGGAGGTGCCAACTCTCCCTCTCAATCC

CTGGGGCTCAAGCCCCCTTGGGGGACCTGCATCCCAGCATGTCGGTAGCTGTGGAGACCTTCGGCTTCTTCATGTCAGCCCTGGGACTGCTGATGCTGGG

GTTGACCCTTTCAAACAGCTACTGGAGAGTGTCTACGGTCCATGGCAACGTCATCACCACCAACACCATCTTTGAGAACCTGTGGTACAGCTGTGCCACC

GACTCCCTGGGAGTCTCCAACTGCTGGGACTTTCCGTCCATGCTGGCCCTCTCTG GGTATGTCCAGGGCTGCCGGGCTCTCATGATCACCGCCATCCTC

CTGGGCTTCCTGGGCCTCTTTCTAGGCATGGTGGGACTCCGCTGCACCAACGTGGGCAACATGGATCTCTCCAAGAAGGCCAAGCTGCTGGCCATTGCAG

GGACCCTCCACATACTTGCTG GAGCCTGTGGGATGGTGGCTATCTCGTGGTACGCCGTCAACATCACTACTGACTTCTTCAACCCACTGTATGCTGGAA

CCAA - UNI27245 - GTATGAACTGGGCCCCGCCCTCTACTTGGGCTGGAGTGCCTCCCTGCTCTCCATCCTGGGCGGCATCTGTGTCTTCTCCACC

TGCTGCTGTTCCTCCAAGGAGGAACCAGCCACCAG GGCTGGGCTTCCCTACAAGCCTTCTACGGTTGTGATACCCCGTGCCACCTCGGATGAGAGTGAC

ATCAGCTTCGGTAAATATGGCAAAAACGCATACGTGTAGGAAGCTCTGGCCTGCTGGACACCATTTCTTGTCCCACTGTCTCCAGGACCTGCAGGCAGAC

CAGTCTCCAGTTAATAACCTCAGGACAGGCCAAATTTCCTGGCCTCACCCTGTGCCTGGAAGCCACTACCCACTCTAGGCACACCTTATCTGGCACTCAG

CCTCTCCCTGGAACAGAAGCTTCAGGGGCAACTTGCCTGCTTCTTACAGCTGGACACAAGGGGACAGAGGTGTCTGCAGCATGTGACTCCATATAAATGT

GTGCATGAATAAATGTATATTGTGATTGTTCAGGGGGCACCAGGGGTCATGGAGTCACAGCCACATAAGGGAGTCCTTTTCAAACCACAGACTGTCAAGT

CTGCCCAATTTGGGGGCTGTCTCATCTAGTGAGATAGTGTGTCAGGGAGCTGGGGAGATGGCTCAGTGAGTTGAGTGTTTGCTACCCAAGTATGAGGACC

TGAGTTCAAATCCCCAGAACCTGTGTAAATGGCAGGCCATGGATACAATCCTGCAACCCAAGTATGCTAGGTTGAGGTATTCTTGAGGCTTCCTGGCTTC

CACCCTGGCTCCAGGCTCCATATGAGACGCAGTCTTAAGGGAATGAGGTGGAGCGCGATGGAGCAGGGAGCTGGAAACCCTCTTCCCACCTTCTCAGGCA

CACAGACTTGTACATAGACTACACACATGCACACATTCTCAACAAAAGGATTTGAAAGGGGGAGTCACTAACAACTGATCTGAGTCACCCACCTCAGGAG

ATTGCTAATAGCTGTGATGCTCCTGGCCTGCTGAAAGTTCCTCTCTGTTGACTCTTGACCTATTTTCTCACAGTCTCACACAGGGGCAGTTGATCTAGAA

CAGGCATTGGTAGGTGCATGTGTGTTTGAAGGTTTGGGGTTTAAAATAAAGATATTTTAAATG
Translation
MSVAVETFGFFMSALGLLMLGLTLSNSYWRVSTVHGNVITTNTIFENLWYSCATDSLGVSNCWDFPSMLALSG GYVQGCRALMITAILLGFLGLFLGMV

GLRCTNVGNMDLSKKAKLLAIAGTLHILAG GACGMVAISWYAVNITTDFFNPLYAGTK - UNI27245 - KYELGPALYLGWSASLLSILGGICVFS

TCCCSSKEEPATR RAGLPYKPSTVVIPRATSDESDISFGKYGKNAYV
Transcript ENSMUST00000111093
Sequence
CTGATGACGTAGG CTGCGGAGCGGAGCAGGCTTGGCTCATTCCTCTGACCTGCCAGGAAGCAGAGCCTCCCAGAGACCAGGCAGAGGCACTCAGACCTG

ACCTCCAGAAGACGGCAGACAAGAATCGCAGCTGGATGAGCGCTCCTTCAGCCTTCTCCCTCCTCAGTCTTCCGTGACATCCCTTTTGGGCCAAAGCCCC

CGGAATTCACCTGGAGGTGCCAACTCTCCCTCTCAATCCCTGGGGCTCAAGCCCCCTTGGGGGACCTGCATCCCAGCATGTCGGTAGCTGTGGAGACCTT

CGGCTTCTTCATGTCAGCCCTGGGACTGCTGATGCTGGGGTTGACCCTTTCAAACAGCTACTGGAGAGTGTCTACGGTCCATGGCAACGTCATCACCACC

AACACCATCTTTGAGAACCTGTGGTACAGCTGTGCCACCGACTCCCTGGGAGTCTCCAACTGCTGGGACTTTCCGTCCATGCTGGCCCTCTCTG GGTAT

GTCCAGGGCTGCCGGGCTCTCATGATCACCGCCATCCTCCTGGGCTTCCTGGGCCTCTTTCTAGGCATGGTGGGACTCCGCTGCACCAACGTGGGCAACA

TGGATCTCTCCAAGAAGGCCAAGCTGCTGGCCATTGCAGGGACCCTCCACATACTTGCTG GAGCCTGTGGGATGGTGGCTATCTCGTGGTACGCCGTCA

ACATCACTACTGACTTCTTCAACCCACTGTATGCTGGAACCAA - UNI27245 - GTATGAACTGGGCCCCGCCCTCTACTTGGGCTGGAGTGCCTCC

CTGCTCTCCATCCTGGGCGGCATCTGTGTCTTCTCCACCTGCTGCTGTTCCTCCAAGGAGGAACCAGCCACCAG GGCTGGGCTTCCCTACAAGCCTTCT

ACGGTTGTGATACCCCGTGCCACCTCGGATGAGAGTGACATCAGCTTCGGTAAATATGGCAAAAACGCATACGTGTAGGAAGCTCTGGCCTGCTGGACAC

CATTTCTTGTCCCACTGTCTCCAGGACCTGCAGGCAGACCAGTCTCCAGTTAATAACCTCAGGACAGGCCAAATTTCCTGGCCTCACCCTGTGCCTGGAA

GCCACTACCCACTCTAGGCACACCTTATCTGGCACTCAGCCTCTCCCTGGAACAGAAGCTTCAGGGGCAACTTGCCTGCTTCTTACAGCTGGACACAAGG

GGACAGAGGTGTCTGCAGCATGTGACTCCATATAAATGTGTGCATGAATAAATGTATATTGTGATTGTTCAGGGGGCACCAGGGGTCATGGAGTCACAGC

CACATAAGGGAGTCCTTTTCAAACCACAGACTGTCAAGTCTGCCCAATTTGGGGGCTGTCTCATCTAGTGAGATAGTGTGTCAGGGAGCTGGGGAGATGG

CTCAGTGAGTTGAGTGTTTGCTACCCAAGTATGAGGACCTGAGTTCAAATCCCCAGAACCTGTGTAAATGGCAGGCCATGGATACAATCCTGCAACCCAA

GTATGCTAGGTTGAGGTATTCTTGAGGCTTCCTGGCTTCCACCCTGGCTCCAGGCTCCATATGAGACGCAGTCTTAAGGGAATGAGGTGGAGCGCGATGG

AGCAGGGAGCTGGAAACCCTCTTCCCACCTTCTCAGGCACACAGACTTGTACATAGACTACACACATGCACACATTCTCAACAAAAGGATTTGAAAGGGG

GAGTCACTAACAACTGATCTGAGTCACCCACCTCAGGAGATTGCTAATAGCTGTGATGCTCCTGGCCTGCTGAAAGTTCCTCTCTGTTGACTCTTGACCT

ATTTTCTCACAGTCTCACACAGGGGCAGTTGATCTAGAACAGGCATTGGTAGGTGCATGTGTGTTTGAAGGTTTGGGGTTTAAAATAAAGATATTTTAAA

TGATGCAGTCTTTGCATGAA
Translation
 MSVAVETFGFFMSALGLLMLGLTLSNSYWRVSTVHGNVITTNTIFENLWYSCATDSLGVSNCWDFPSMLALSG GYVQGCRALMITAILLGFLGLFLGM

VGLRCTNVGNMDLSKKAKLLAIAGTLHILAG GACGMVAISWYAVNITTDFFNPLYAGTK - UNI27245 - KYELGPALYLGWSASLLSILGGICVF

STCCCSSKEEPATR RAGLPYKPSTVVIPRATSDESDISFGKYGKNAYV

For any suggestions or comments, please send an email to unitrap@crg.es