Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001750 (Tcirg1)
Chromosomal location
Chr 19: 3896052 - 3907040 (-)
Description
T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3 Gene [Source:MGI Symbol;Acc:MGI:1350931]
RefSeq_peptide
NP_058617.2 NP_001129563.1 
UniGene
Mm.271689 
MGI
MGI:1350931 
Uniprot/SPTREMBL
Q91W06 Q9CTA9 Q9JHF5 Q9JL12 
Human Ortholog
ENSG00000110719 (TCIRG1)
Omim 259700 - OSTEOPETROSIS, AUTOSOMAL RECESSIVE 1  
UniTrap UNI20162
Vector Insertion
Chr 19: 3904706 - 3907018
Public Clones (ggtc)
Private Clones OST370963 (lexicon) OST138659 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22337
Vector Insertion
Chr 19: 3904296 - 3904584
Public Clones not available
Private Clones OST299869 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32182
Vector Insertion
Chr 19: 3898979 - 3902036
Public Clones IST14142H2 (tigm) IST14846D6 (tigm) IST10454H12 (tigm) IST14666C8 (tigm)
IST11629G6 (tigm) IST12317B12 (tigm) IST11186H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000001801
Sequence
GTTGAGCGAAGAGTCCACCTGG - UNI20162 - GATCATGGGCTCTATGTTCCGGAGTGAAGAGGTGGCCTTGGTCCAGCTCCTGTTGCCCACAGGG

TCTGCTTACAACTGTGTGAGCCAGCTTGGTGAGCTGGGCCTCGTGGAGTTCAGAGAC - UNI22337 - CTCAACGAATCCGTGAGCGCCTTCCAGAG

ACGCTTCGTGGTAGACGTCCGGCGCTGCGAGGAACTGGAGAAGACGTTTA CCTTCTTGCGGGAAGAAGTGCAGCGGGCAGGTCTGACGCTGGCCCCACC

TGAGGGGACACTGCCAGCACCACCTCCCCGAGACCTGCTGCGCATCCAGGAGGAAACGGATCGCTTGGCCCAGGAGCTTCGGGATGTTCGTGGCAATCAG

CAGGCACTGCGGGCCCAGCTGCACCAGCTGCGGCTTCACTCGGCTGTGCTGGGCCAGAGCCACAGCCCGCCG GTGGCAGCTGACCATACTGAAGGACCC

TTCTCTGAGACAACACCCCTGCTTCCAGGCACCCGGGGGCCACATTCAGACCTGAAGGTCAA TTTTGTGGCAGGTGCTGTGGAGCCCTACAAGGCTGCG

GCCCTGGAGCGCCTGCTGTGGAGAGCTTGCCGCGGCTTCCTCATTGCCAGCTTTCGGGAGACTGAGGGGCAGCTGGAGGACCCAGTGACG GGTGAGCCT

GCAACTTGGATGACCTTTGTCATCTCCTACTGGGGTGAGCAGATCGGACAGAAGATCCGAAAGATCACAGACTG CTTCCACTGTCATGTCTTCCCATAC

CTGGAGCAGGAGGAAGCCCGGTTCAGGACCTTGCAGCAGCTGCAGCAGCAAAGCCAGGAGCTTCAGGAA GTCCTGGGGGAGACAGACCGGTTCCTGAGC

CAGGTGTTGGGCCGGGTGCAGCAGCTGCTGCCCCCATGGCAGGTGCAGATCCACAAGATGAAGGCAGTGTACCTGACCCTCAACCAGTGCAGTGTGAACA

CCACACACAAGTGCCTCATCGCGGAGGTCTGGTGTGCCGCGAGGGACCTGCCCACTGTGCAGCAGGCGCTGCAGAGCGGCTCA - UNI32182 - AGT

GAGGAAGGAGTGAGTGCTGTCGCTCACCGCATCCCCTGCCAGGACATGCCTCCAACCCTCATCAGGACCAACCGCTTCACCTCCAGCTTCCAGGGCATTG

TGGATGCCTATGGTGTGGGCCGCTACAGGGAAGTTAACCCTG - UNI32182 - CTCCCTACACCATCATCACATTCCCCTTTCTCTTCGCTGTGATG

TTTGGCGATGTGGGGCACGGACTGCTCATGTTTCTCTTTGCCCTGGCCATGGTCCTCACTGAAAACCGTCCAGCTGTGAAGGCTGCACAAAACGAG - U

NI32182 - ATCTGGCAGACCTTCTTTGGGGGTCGATACCTACTCCTGCTCATGGGTCTGTTCTCCGTCTACACTGGCTTCATCTACAATGAGTGCTTC

AGCCGAGCCACCACTATTTTCCCCTCAGGTTGGAGTGTGGCTGCCATGGCCAACCAGTCAGGCTGGAG TGACGAGTATCTGTCCCAGCACTCCATGCTC

ACCCTGAACCCTAACATCACTGGTGTCTTCCTTGGACCATATCCCTTTGGCATTGACCCG ATCTGGAGCCTGGCCACGAACCACCTGAGCTTTCTCAAC

TCCTTCAAGATGAAGATGTCTGTCATCCTTGGGGTCACGCACATGGCCTTTGGGGTGTTCCTCAGCATCTTCAACCACGT GCACTTTGGCCAGGCCCAC

CGGCTACTGCTGGAGACCTTGCCTGAGCTCATCTTCCTGCTGGGTCTCTTTGGCTACCTTGTGTTCCTCATTGTCTACAAGTGGGTGAATGTCTCAGCTG

CTAGCGCCTCCTCGGCCCCCAGTATCCTCATTCACTTCATCAATATGTTCCTCTTCTCTCAAAACCCCACCAATCATCTGCTCTTCCATGGGCAG GAAG

TGGTACAGTACGTGCTGGTGGTCCTGGCTTTGGCTACCGTTCCTATCCTGTTGCTGGGCACACCCTTGTACCTGCTGCGCCAGCACCGCCACAGAAGAAA

CACTCAGAGAAGGCCAGCAGGCCAGCAG GATGAGGACACGGACAAGCTTCTGGCCTCCCCTGATGCATCCACCTTGGAGAACAGCTGGAGCCCTGATGA

GGAGAAGGCTGGGAGCCCAGGGGATGAAGAAACTGAG TTTGTCCCTTCTGAGATCTTCATGCACCAAGCAATCCACACCATTGAGTTCTGCCTGGGCTG

CATCTCCAACACAGCCTCCTACTTGCGTCTCTGGGCCCTGAGCCTGGCCCATGCCC AGCTGTCTGAGGTCCTGTGGGCCATGGTGATGCGCATAGGCCT

GGGCATGGGCCGAGAGATCGGCGTGGCAGCTGTGGTGCTGGTCCCTGTGTTTGCTGCCTTTGCTGTGTTGACTGTGGCCATCCTGTTAGTGATGGAGGGG

CTCTCAGCCTTCCTGCATGCCCTGCGGTTGCACTG GGTGGAGTTCCAGAACAAGTTCTATTCAGGCACCGGCTACAAGCTCAGCCCCTTCACCTTCACT

GTGGACAGTGACTAGCTACCCACTGCAATCCCTGCTTCTCCGAAGTGGGACAGGAATAAAGAGCTGGCTGGCCCAGG
Translation
 - UNI20162 - MGSMFRSEEVALVQLLLPTGSAYNCVSQLGELGLVEFRD - UNI22337 - LNESVSAFQRRFVVDVRRCEELEKTFT TFLRE

EVQRAGLTLAPPEGTLPAPPPRDLLRIQEETDRLAQELRDVRGNQQALRAQLHQLRLHSAVLGQSHSPP VAADHTEGPFSETTPLLPGTRGPHSDLKVN

 NFVAGAVEPYKAAALERLLWRACRGFLIASFRETEGQLEDPVT GEPATWMTFVISYWGEQIGQKIRKITDC CFHCHVFPYLEQEEARFRTLQQLQQQ

SQELQE VLGETDRFLSQVLGRVQQLLPPWQVQIHKMKAVYLTLNQCSVNTTHKCLIAEVWCAARDLPTVQQALQSGS - UNI32182 - SEEGVSAV

AHRIPCQDMPPTLIRTNRFTSSFQGIVDAYGVGRYREVNPA - UNI32182 - APYTIITFPFLFAVMFGDVGHGLLMFLFALAMVLTENRPAVKAAQ

NE - UNI32182 - IWQTFFGGRYLLLLMGLFSVYTGFIYNECFSRATTIFPSGWSVAAMANQSGWS SDEYLSQHSMLTLNPNITGVFLGPYPFGID

P IWSLATNHLSFLNSFKMKMSVILGVTHMAFGVFLSIFNHV VHFGQAHRLLLETLPELIFLLGLFGYLVFLIVYKWVNVSAASASSAPSILIHFINMF

LFSQNPTNHLLFHGQ EVVQYVLVVLALATVPILLLGTPLYLLRQHRHRRNTQRRPAGQQ DEDTDKLLASPDASTLENSWSPDEEKAGSPGDEETE FV

PSEIFMHQAIHTIEFCLGCISNTASYLRLWALSLAHAQ QLSEVLWAMVMRIGLGMGREIGVAAVVLVPVFAAFAVLTVAILLVMEGLSAFLHALRLHW 

WVEFQNKFYSGTGYKLSPFTFTVDSD

For any suggestions or comments, please send an email to unitrap@crg.es