Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001855 (Nup214)
Chromosomal location
Chr 2: 31829970 - 31909495 (+)
Description
nucleoporin 214 Gene [Source:MGI (curated);Acc:Nup214-001]
RefSeq_dna
NM_172268 
RefSeq_peptide
NP_758472.2 
UniGene
Mm.289686 
MGI
MGI:1095411 
Uniprot/SWISSPROT
Q80U93 
Uniprot/SPTREMBL
A2ATN3 Q3TLG4 Q3UBL1 Q8CHS9 
Human Ortholog
ENSG00000126883 (NUP214)
Omim not available
UniTrap UNI29279
Vector Insertion
Chr 2: 31830129 - 31832019
Public Clones not available
Private Clones OST884 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6026
Vector Insertion
Chr 2: 31836101 - 31838130
Public Clones CSH598 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8608
Vector Insertion
Chr 2: 31846946 - 31850042
Public Clones RRC269 (baygenomics) RRC052 (baygenomics) RRC060 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4302
Vector Insertion
Chr 2: 31852072 - 31853472
Public Clones AG0208 (sanger) XG664 (baygenomics) XG654 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32407
Vector Insertion
Chr 2: 31859992 - 31862208
Public Clones IST14792D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3595
Vector Insertion
Chr 2: 31862313 - 31865702
Public Clones BC0066 (sanger) (sanger) P023F01 (ggtc) D056H06 (ggtc) P022F01 (ggtc)
CMHD-GT_329G5-3 (cmhd) IST12363G5 (tigm) IST12641D1 (tigm) IST12506A6 (tigm)
Private Clones OST357502 (lexicon) OST58049 (lexicon)
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6996
Vector Insertion
Chr 2: 31875878 - 31880762
Public Clones RRZ232 (baygenomics) IST10668H10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14839
Vector Insertion
Chr 2: 31882447 - 31886226
Public Clones (sanger) PST6305-NL (escells) PST2794-NR (escells) PST13438-NL (escells)
PST4968-NL (escells) PST11010-NR (escells) PST1765-2 (escells) PST5478-NL (escells)
PST11131-NL (escells) PST1765-1 (escells) PST6305-NR (escells) PST2863-NR (escells)
PST5078-NR (escells) PST10400-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12039
Vector Insertion
Chr 2: 31890490 - 31893621
Public Clones A061E08 (ggtc)
Private Clones OST368100 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6512
Vector Insertion
Chr 2: 31894997 - 31897936
Public Clones YHC472 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23336
Vector Insertion
Chr 2: 31907319 - 31907638
Public Clones not available
Private Clones OST263238 (lexicon)
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000065398
Sequence
GCGGGCGCTGAGGGAAGGAAGTTGAGGCCTGAGCGGCCTGAGCTGTGTTTGAAAGGCCGCGGGTGGCAGCGGCAGCGCCAGCAGCAGCTACTTGAACACC

CTGAAGGCGGCACGATGGGAGACGAGATGGATGCCATGATCCCTGAGCGGGAGATGAAG - UNI29279 - GACTTTCAGTTTAGAGCACTGAAGAAA

GTGAGGATCTTTGACTCTCCTGAAGAGTTGCCCAAGGAGCGCTCGAGTGTGCTTACCATATCCAATAAGTATGGTATGCTCTTCGCTGGTGGCACCAATG

GCTTGAATGTTTTTCCTACTAAAAGCCTTCTTATCCAAAATAAACCTGGAGATGATCCCAATAAAATTG TTGACACAATTCAAGGCTTGAATGTTCCTA

TGAAATTCCCAGTCCATCACCTAGCACTGAGCTGTGATAGTCTTACACTCTCTGCCTGCATGATGTCTAGTGAATACGGCTCCATTATAGCTTTTTTTGA

TGTTCGCACATTTTCAAATCAG GCTAAACCATTGAAACGTCCATTTACCTATCACAAGGTTTCAAACGATGCCAGCGGAATGGTGAATGATATGAAGTG

GAACCCCACTGTCCCTTCCATGGTGGCAGTTTGTCTGGCTGATGGCAGTATTTCTGTCTTGCAAGTTACAGATGTGGTGAAAGTATGCGCCACACTTCCT

CCTTCCACAGGAGTCACATGTG TATGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTAGGAAAGCAGAATGGAACTGTGGTCCAGTACCTTCCT - UNI

6026 - ACTTTGCAGGAAAAAAAGGTCATTCCATGTCCTCCATTTTATGAGTCAGATCATCCTGTCAGAG TTCTGGATGTGCTATGGATTGGTACATA

TGTCTTCACGATAGTCTATGCTGGTGCAGATGGAACCTTGGAGACCTGTCCAGATGTGGTGATGGCTCTACTCCCG AAAAAAGAAGAAAAGCATCCAGA

AATATTTGTGAACTTCATGGAGCCCTGCTACAGCAGCTGCACAGAGAGACAACATCATTACTACCTCAGCTACATCGAGGAGTG GGATTTAGTGCTGGC

AGCATCTGCAGCTTCTACAGAAGTTAGCATCCTTGCTCGACAAAATGATCAG ACTAATTGGGAATCTTGGCTGCTGGAGGACTCTAGTCGAGCTGAACT

GCCTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGTGTTGCCATAGATTATACCAATGAAGTGGAAGTCACCATCA ATGAAGAAAAGACTCTTCC

GCCTGCTCCGGTTCTCCTGTTACTTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATCAACCAAAATCCTGGGGTTAGGTCCCTAATCAAGACCTTG

GAACTGATCTCAACAGAAGGAGAGCGACAGCCTAAGTCCTCAG - UNI8608 - GAAGTTTTCCTGGTACTCCATCTTCCCCTCAAGCTCCACAAAAC

CTGGACGCTCCAGCAACAGCCTCTTCGCCTCTTCCACCTGTGTCCGCTGCTCCCACCTCCACCTTCCCTATGCCCTCTGCTGCAGGAAGCCCTTCTGTGT

TCTCCTTTGGCCCTTCATCCTTCAAGTCTTCTGCTTCTGTCACCGGGGAGCCCCCACTGTACCCCACTGGCTCCGACAGCTCCAGAGCAGCACCAGGCTC

TGGCACCTCCACTTTCTCTTTTGCTCCTCCTTCCAAAGGCTCCCTGGCGTCGACCCCTGCAGTGGCTCCTGTGGCCACATCTGCTGCTCCCTTCACTTTT

GGTTTTAAGCCCACCTTGGAAAGCACACCTATGTCCAGTACCCCAAACACAGGGATGAAGCCTTCGTTCCCTCCCTCGGCCTCTTCGGTGAAAGTCAACC

TGAATGAGAA GTTCACCGCTGTGGCCTCCTCTGCACCTGTTCATAGCTCCACGAGCACACCCTCCGTGTTGCCGTTCTCCTCCTCCCCGAAGCCAACGG

CTTCTGGACCACTCAGCCATCCTACGCCTCTCCCAGCATCATCCAGCTCCATGCCTTTGAAGTCTTCGGTCTCTCCCTCGCCAGCAG - UNI4302 - 

CTGGCCGCTCCACTCAGACTGCGCCAAGTTCAGCACCCTCCACAGGGCAGAAATCACCCAGGGTAAACCCTCCAGTGCCAAAGTCAGGTTCTTCTCAG G

CCAAGGCACTTCAGCCTCCTGTCACAGAGAAACAGAGGCCTCAGTGGAAAGACTCAGACCCCGTGCTGGCTGGGATTGGAGAGGAG ATTGCACACTTCC

AGAAAGAACTAGAGGAGTTAAAGGCCCGGACCGCCAAAGCCTGTCTCCAGGTTGGCACCTCAGAAGAGATGAAGATGCTGCGGACAGAGTCAGATGACTT

GCACACCTTTCTTTTTGAGATTAGAGAGACCACAGAG TCTCTTCATGGAGACATAAGTACTCTGAAAACAACTTTGCTGGAGGGCTTTGCTGGGGTCGA

AGAAGCCAGAGAACAGCACGGAAGAAATCACGACTCTGGGTATCTCCACCTGCTTTATAAAAGACCGCTGGATCCCAAGAGCGAGGCCCAGCTCCAG - 

UNI32407 - GAAATTCGCCGCCTTCACCAGTACGTGAAATTTGCTGTCCAGGATGTGAATGACGTCCTAGACTTAGAGTGGGATCGGCATCTGGAGCA

GAAGAAGAGACAGAG - UNI3595 - GCGCCTAATTGTGCCAGAACGAGAGACACTTTTCAACACGCTAGCCAACAACCGGGAGATCATCAACCAGCA

GAGGAAGAGGCTGAATCAGCTGGTGGACAGTCTGCAGCAGCTCCGTCTCTATAACCACACGGCCCCGTGGAGCCTGCCCTCAGCGCTCTCAACTCAGAGC

AACAGTCACAG TTTTGACAGTGACCTTGAATGCCTGCTAAAAACTACCATTGAATCTCACACCAAGCCTTCTCCCAGAGTGCCAG GTAAATTGTCCCC

GGCGAAACAGGCCCAACTGAGGAACTTCTTGGCCAAAAGGAAGACCCCACCAGTGAGGTCTACTGCTCCAG CCAGCCTGTCCCGGTCAGCCTTCCTATC

TCAGAGGTACTATGAAGACTTAGATGAAGGCAGCTCCGCGTCATCCGTAGCTCAGCCTCTGGAGGGAGAAGATGCCCGGCCAACCTGCACATCTGTAGCT

CAGCCTCTGGAGGGAGAAGATGCCCAGCCAATCTGCAAAGAGGAAGAGGCTGTGGTCCCAGTACCTCGGCATGCCCCTGTGGTCCGCACACCTTCTATCC

AACCCAGTCTCCTGCCTCAGTCGATGCCCTTTGCAAAGCCTCACCTGATCCATAGTTCTTCACCTGCCGTGATGAGCTCTGCAG TCTCTACGTCAGCCA

CCAAAGTTATTCCTCAGGGAGCAGACAGCACAATGCTGGCAACTAAAACAGTAAAGCACGGTGCACCAGGTCCTTCCCACACTGTTGCAGCTCCCCAGGC

CGCAGCTGCTGCAGCCCTAAGACGGCAGATGGCCAGTCAGGCACCAG CTATGAGCACTCTGACCGAATCAACTCTGAAGACTGTCCCTCAGGTGGTGAA

TGTACAGGAACTGAGGAGTAATCCCTCGCCCCCATCTGCGGCCATGGG - UNI6996 - TTCTGCCGTGCAGCACTCAGCAGCCAAAACACCCCATGC

TGTGTTAACCCCCGTGGCTAACAGCCAAGCCAAGCAG GGGTCTCTGATAAATTCTTTCAAGCCGTCAGGACCCACAGCAGCATCCTGTCAGCTGTCCTC

TGGGGATAAAGCTGTAG - UNI14839 - GTCAAGGGACAGCCAAGACAGAGTCCGCTGCGACCTCGACTCCATCTGCTGCAGGACAGCTCAACAAGC

CTTTCTCATTCGCCTCCCCAGG GACCTTTACTTTTGGGACAATCACACCAACCCCATCTTCTAGTTTCACTGCCACACCAG GGGCAGGACCCCCTACT

AAAGAGCCAACCCAGCTTGAGGCATTCTCATTTGGCGGGGGAGGCAAACCTTTCTCTGAGGCCATTCCTGGGAACTCCCCTGCCACAGGAGCAACATCGG

CACCCAGCACTTCTGTAACAGCTGCCTCTCTGGAAGACTCTGCTCCATCCAGCAGCAAACCTGCAGCTCCTCCTGAAACTACTGTGTCCTCTGCTTCTAG

CAAATTGGAAACTCCACCGTCCAAGTTAGGAGAGCTTCTGTTCCCAAGCTCTCTAGCTGGAGAGACGCTGGGGAGCTTCTCGGGCCTGCGTGTTGGCCAA

GCTGAGGATTCTACTAAGCCAGTTAGTAAGGCCTCCTCCACAAACCTAGCTGGAGCCCAGCCAGCTAAGCCCTCAGGGGTTAGCTTTCCTAATACTTCAG

TGTTAGGGAAGCCAGTGGAGCCCGCTGTGACCTCCTCTGTGAGCCCCGCCCCAGCAGCACCAGCCTCAGCTCTGAATGTGAGCACTAGCAGTTCCTCAGC

AACTGTCTTTGGCAGTGTGCCCCTTACCAGTGCTGGACCTCCTGGGCTCATCAGTTTTGGTGGGGCTGCTTTGGCTAGTAGCAAAGCTAGTTTCTCATTT

GGAAACCAGCAGACTAGTAGTAGTACAGCATCATCAGCTACCCCAACATCGACCTCAGTTGCCCCTTCCCTTCCAGCATCTTTCCCTACTTTGTCATTTG

GTGGCCTCCTGAGTTCACCATCAGCTTCTTCCCTGCCCGTGTCCTCTGGTAAGAGTACAGAGGAGGCAGCACCACCAGCTGTTCCTGACAAGTCAGACAG

CAGTGAAGTTTCAGCAACAACACCCTCACTTCCAGTACAGCCACAGTCAACCCAGGCATCTCTGCAAACTTCTGACCCTGTCAAAAAAGAACCTGTTCTT

GTGCAGACCACAGACAGCAGCCCCAGCAGACCAGCATCTTCTGCCAGCTTTGTGGCATCCACAGAGTCCATGCCAGTAACCCTAGGGGCCCCTGACAGCA

AGATAGAGGCAGTGTCTCCTGCGTCCACCTTTGCAGGGCCTGGACAGGCTGCTGTGGCAACAGCTGTTCTCCCAGGAGCAGGCTCGGCAGCCACTGAAGC

ATCGGGTACCCCTACCACCTCCACTGTCTCCAGCAGTAGCCCAACTTCTGCCACAGAGACAGCTGTATTTGGGACTGCCACATCTGGTTCCTCAGTCTTT

ACACAGCCACCTGCTGCCAGTTCTAGCTCAGCGTTCAGCCAGCTCTCCAGTAACACAGCCACTGCGCCCTCTGCCACCCCTGTGTTTGGGCAAGTGGCAG

CCAGCATAACCAGCACAGCCGCTGCCACACCACAGGCCAGCAGTTCAGGGTTTGGCAGCCCTGCATTTGGTGCTTCAGCTCCTGGAGTGTTCGGACAGAC

AGCATTTGGGCAGACCCCAGCCTTTGGGCAAGCAACAAGCAGCCCTGCCAGTGGCTTCTCCTTCAGCCAGCCTGGGTTCAGTTCCGTGCCTGCTTTCGGC

CAGTCTGTCTCCTCTACCCCCGCATCCACCAGTGCAAATGTCTTTGGAGCCACCTCGAGTACCAGCAGTCCTGGTTCCTTCTCATTTGGACAGGCTTCTA

CCAATACAGGAGGGACGCTGTTTGGTCAAAACAACCCTCCTGCTTTTGGTCAGAGCCCTGGCTTTGGGCAGGGAAGCTCTGTGTTTGGTGGCACCTCGGC

CACTACCTCTACAGCAGCACCTTCAGGGTTTAGCTTTTGTCAAGCCTCCG - UNI12039 - GTTTTGGGTCTAGTAATACTGGTTCTGTGTTTGGCC

AGGCAGCCAACACTGGTGGGTCAGTCTTTGGCCAG TCATCCACTTCCAGTGGTGGCGTGTTTGGGTCTGGAAATGCTACAAGAGGGGGCGGTTTCTTCA

GTGGCCTTGGAGGAAAACCCAGCCAGGATGCTGCCAACAAAAACCCCTTCAGCTCAGCCGGTGGGGGCTTTGGATCTACAGCTGCCCCAA - UNI6512

 - ATACCTCTAATCTGTTTGGAAACAGTGGAGCTAAGACATTTGGAGGGTTTGGCAGCTCATCCTTCGGGGAACAGAAGCCTGCCGGCACATTCAGCTC

TGGCGGTGGGAGCGTAGCATCCCAAGGTTTTGGATTTTCCACTCCAAATAAAACAG GTGGCTTCGGTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTTT

TGGGGGATCCCCTGGGTTTGGAGGGGTGCCAGCATTCGGTTCAGCCCCAGCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAGTGTTCGGAGAGGGT

ACTGCGGCTGCCAGCGCAGGCGGATTCGG GTTCGGGAGCAGCGGCAATACTGCATCCTTCGGTACCCTCGCCAGTCAGAACGCACCCACCTTCGGGTCC

TTGTCCCAGCAGACCTCAGGCTTTGGGACCCCGAGCAGTGGATTCGCTGGGTTTGGATCGGGCACAGGAG CCTTCACCTTTGGATCATCTAACTC - U

NI23336 - GTCTGTCCAGGGCTTCGGTGGCTGGAGAAGCTGAGCTGATGTCAGCATTCCCTCAAGTTCCTGTGAGCTCCTGTGCGCATCCCTCCACAG

CAACAGACTGTCAAAAGAACTTTCTCATGAAAACGCTCAGCCAGGAAGAAACACTGGAGACCAAAGCTCAGCAATGCTTAACTAACTGCCTGTTCCCCGC

TTTCAAATTTTACATCAAGTTTTTCGTCTGCTATTAAAGTGTTTGGTCTGGTTCTGCACAGAACATCTGGGTATTTATTTGGGTCACAGCCAGAGACATT

CCTATGGCTTGAGGAAACCAAGCCAGTGGTCTCTGCCCAGTGGCATTCTGAGTAGAGCCCCTCTACATGGAAAAGAGCAGAATGTGGCAGACACCTCCCC

ACGTTAATGTCTATGCCACATGTTCTGTGGTTCCATGTCAGGCTCCTGTGAGGGCCCCTTCCTTCACAGCCAGTTCTAAGACAGGTATGGCAAACAGACC

AGGGAGGCAGCCGCTGAGCTGCCTGTCACCTGCCACCCTGTCTCTGCTCCTGCATGCTCTGCATCTGCTGCCAGTTCCCAGTGCAGAGGCAGTCTGCTGA

TCGTCTCCATACACAGCATTTGCAGACCTACAAACACCACGTCCTTCCTTCACTGTTTGGAACCCACGACTTACGGGGACATCAACAAGTCGCTGCAGGC

TTGGACAGTGTGCGAATCCATTTTAGACATGCTTCTTTCTCTGGGTGCGTTAGCTTTGAGGGCCTGGCATGTTCTGCTCCTTGGGCTGTGGAGTCCTGTG

CTACCAAAGCCTCTGCAGAGACCATCTGTCACCTTTCAGGTTCACAACATGGCACTGCTCTGGACTGGGTCAAGGGCAGAGGGAAGAGCTGTGGGTTGGG

GTTTGTCATACTGGAAAGGTTTTGGTTCCTTTGTTGTTCAGGGGTTGTTCTTGTTTTTGAGACAGGGCTTCCCTGTGTAGCTGGCTGTCCTGGAACTTGC

TCTGTAGACCAGGCTGGCCTTGAACTCAGAGAACTGCCTACCTCTGTCTCCTGAGTGCTGGGATTAAAGGCATGCCCACTACCACCTTGCTAAGATGCTG

TTTTGTAATGCTTTAAGGTCATGGTGCAGTCAGTGTGACTGTGGTCCTATTGGCTTTTGTGTCCCCCATGCCACAGCTTGCTCAGGTGTGCCCTTATGTC

TCAGCCTTGGCCTCAGACAGGGAGTTCAAGCCTCCATCCATCCTTATTCAGGGGAAGAACATGACCATCAGGGATGGGCGCTCCCCCAGAGTGTTCAGTG

GCTTCTTATCATCTCAAGAGGAATCTGCCCTGCTGGGTTCCTAACCAGCCATCACCAGAGCCAAGACAAGACCTAGAATTAGGCACAGGGTCCACCCGGA

CTGTCACCCATTCTCTGTGCCACAGAGACTTGTCTGCATGCTTCACTCATTAGGGGCTCTGCCTCTTCTGAGGAGCTGGAGCCTTGAGAGCCTCAGTGTG

GCCTCCTTTTGGTCCTTTGGGAATTGAAGAGCCAGGCACCGCTTGAGGCCCCTCTGCCCGGAAGCAGGTCTGTCTCTCCGTATGCTTGGAACTTTGCCGA

CCAGGTCTCTCAGACCAAGGGATCGCCAGGCTTCTTTTTGTGTCAGGGTCTCACTCTGCAGCCCTGGCTGGCTTCAAACTCTCTGATCCACCCTTTCCGA

TATATATCAAGTGCTGGGAAGAAAGGCACTTGCTCCAGGCTTTCTGGGTTTGATGGGGAACATTCATGGATGAGGACTATAACTGGGTAAAGAGAGGGAA

GAGCCCGTTTTGTTACCTGAAGAGGAAGACTGAGATTAAAAATGGAAATGAAGGAGTTAGTGAACTG
Translation
MGDEMDAMIPEREMK - UNI29279 - DFQFRALKKVRIFDSPEELPKERSSVLTISNKYGMLFAGGTNGLNVFPTKSLLIQNKPGDDPNKIV VDTI

QGLNVPMKFPVHHLALSCDSLTLSACMMSSEYGSIIAFFDVRTFSNQ AKPLKRPFTYHKVSNDASGMVNDMKWNPTVPSMVAVCLADGSISVLQVTDVV

KVCATLPPSTGVTCV VCWSPKGKQLAVGKQNGTVVQYLP - UNI6026 - TLQEKKVIPCPPFYESDHPVRV VLDVLWIGTYVFTIVYAGADGTLE

TCPDVVMALLP KKEEKHPEIFVNFMEPCYSSCTERQHHYYLSYIEEW WDLVLAASAASTEVSILARQNDQ TNWESWLLEDSSRAELPVTDKSDDSLP

MGVAIDYTNEVEVTIN NEEKTLPPAPVLLLLSTDGVLCPFYMINQNPGVRSLIKTLELISTEGERQPKSSG - UNI8608 - GSFPGTPSSPQAPQN

LDAPATASSPLPPVSAAPTSTFPMPSAAGSPSVFSFGPSSFKSSASVTGEPPLYPTGSDSSRAAPGSGTSTFSFAPPSKGSLASTPAVAPVATSAAPFTF

GFKPTLESTPMSSTPNTGMKPSFPPSASSVKVNLNEK KFTAVASSAPVHSSTSTPSVLPFSSSPKPTASGPLSHPTPLPASSSSMPLKSSVSPSPAA -

 UNI4302 - AGRSTQTAPSSAPSTGQKSPRVNPPVPKSGSSQ AKALQPPVTEKQRPQWKDSDPVLAGIGEE IAHFQKELEELKARTAKACLQVGTS

EEMKMLRTESDDLHTFLFEIRETTE SLHGDISTLKTTLLEGFAGVEEAREQHGRNHDSGYLHLLYKRPLDPKSEAQLQ - UNI32407 - EIRRLHQ

YVKFAVQDVNDVLDLEWDRHLEQKKRQR - UNI3595 - RRLIVPERETLFNTLANNREIINQQRKRLNQLVDSLQQLRLYNHTAPWSLPSALSTQSN

SHS SFDSDLECLLKTTIESHTKPSPRVPG GKLSPAKQAQLRNFLAKRKTPPVRSTAPA ASLSRSAFLSQRYYEDLDEGSSASSVAQPLEGEDARPTC

TSVAQPLEGEDAQPICKEEEAVVPVPRHAPVVRTPSIQPSLLPQSMPFAKPHLIHSSSPAVMSSAV VSTSATKVIPQGADSTMLATKTVKHGAPGPSHT

VAAPQAAAAAALRRQMASQAPA AMSTLTESTLKTVPQVVNVQELRSNPSPPSAAMG - UNI6996 - GSAVQHSAAKTPHAVLTPVANSQAKQ GSL

INSFKPSGPTAASCQLSSGDKAVG - UNI14839 - GQGTAKTESAATSTPSAAGQLNKPFSFASPG GTFTFGTITPTPSSSFTATPG GAGPPTKE

PTQLEAFSFGGGGKPFSEAIPGNSPATGATSAPSTSVTAASLEDSAPSSSKPAAPPETTVSSASSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQAE

DSTKPVSKASSTNLAGAQPAKPSGVSFPNTSVLGKPVEPAVTSSVSPAPAAPASALNVSTSSSSATVFGSVPLTSAGPPGLISFGGAALASSKASFSFGN

QQTSSSTASSATPTSTSVAPSLPASFPTLSFGGLLSSPSASSLPVSSGKSTEEAAPPAVPDKSDSSEVSATTPSLPVQPQSTQASLQTSDPVKKEPVLVQ

TTDSSPSRPASSASFVASTESMPVTLGAPDSKIEAVSPASTFAGPGQAAVATAVLPGAGSAATEASGTPTTSTVSSSSPTSATETAVFGTATSGSSVFTQ

PPAASSSSAFSQLSSNTATAPSATPVFGQVAASITSTAAATPQASSSGFGSPAFGASAPGVFGQTAFGQTPAFGQATSSPASGFSFSQPGFSSVPAFGQS

VSSTPASTSANVFGATSSTSSPGSFSFGQASTNTGGTLFGQNNPPAFGQSPGFGQGSSVFGGTSATTSTAAPSGFSFCQASG - UNI12039 - GFGS

SNTGSVFGQAANTGGSVFGQ SSTSSGGVFGSGNATRGGGFFSGLGGKPSQDAANKNPFSSAGGGFGSTAAPN - UNI6512 - NTSNLFGNSGAKTF

GGFGSSSFGEQKPAGTFSSGGGSVASQGFGFSTPNKTG GGFGAAPVFGSPPTFGGSPGFGGVPAFGSAPAFTSPLGSTGGKVFGEGTAAASAGGFG GF

GSSGNTASFGTLASQNAPTFGSLSQQTSGFGTPSSGFAGFGSGTGA AFTFGSSNS - UNI23336 - SSVQGFGGWRS

For any suggestions or comments, please send an email to unitrap@crg.es