Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001924 (Uba1)
Chromosomal location
Chr X: 20235452 - 20260305 (+)
Description
ubiquitin-like modifier activating enzyme 1 Gene [Source:MGI (curated);Acc:Uba1-001]
Human Ortholog
not available
Omim not available
UniTrap UNI36951
Vector Insertion
Chr X: 20235653 - 20240056
Public Clones 5SP115F05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000089217
Sequence
GAGGCGCAGAAGTAGAGAGAAATGCCCCTCTATTCAGGCGTCTATGGTATACCCCAGACCCGGCCCTCTAAGGCCCCCGCGCTTCCGAGCTCCGCGCAAA

CTCTGGTTCTTTTTGCACGATCGAGGTGGTTTGCTCTTCCGTTGCCCTGTGGCTTCGGCTTGTCTCCAGAAGGAAGGCGAGGCTTCCGCCCAGCACTGGG

G - UNI36951 - ATGTCCAGCTCGCCGCTGTCCAAGAAACGTCGCGTGTCCGGGCCTGATCCAAAGCCGGGTTCTAACTGCTCCCCTGCACAGTCTG

CGCTGTCCGAAGTGTCCTCAGTGCCAACCAAC GGAATGGCGAAGAACGGCAGTGAAGCAGACATAGACGAGAGCCTTTACTCCCGGCAGCT GTACGTT

TTGGGCCATGAGGCAATGAAAATGCTCCAGACATCCAGCGTCCTTGTCTCAGGCTTGCGGGGCTTGGGTGTAGAAATTGCTAAGAACATCATCCTTGGTG

GGGTCAAGGCTGTCACCCTACATGACCAAGGAACTACCCAGTGGGCTGATCTCTCCTCCCAG TTTTACCTTCGGGAGGAGGACATTGGTAAAAATCGAG

CGGAGGTATCCCAGCCCCGACTTGCTGAACTCAACAGCTATGTACCTGTCACTGCCTACACTGGGCCTCTTGTCGAGGACTTCCTTAGTAGCTTCCAG G

TGGTGGTCCTCACCAACAGCCCCCTGGAAGCCCAGCTGCGAGTGGGGGAGTTCTGTCATAGCCGTGGTATCAAGCTAGTGGTGGCAGATACAAGAGGCCT

GTTTGG GCAACTTTTCTGTGATTTTGGAGAGGAAATGGTCCTCACAGATTCCAATGGGGAGCAGCCACTCAGTGCTATGGTTTCAATGGTCACCAAG G

ACAACCCCGGTGTGGTTACCTGCCTTGATGAGGCCCGACATGGCTTTGAGACTGGTGACTTCGTCTCATTCTCAGAAGTACAGGGCATGATCCAACTCAA

TGGATGTCAGCCCATGGAGATCAAAGTGCTGG GTCCTTATACCTTTAGTATCTGTGACACTTCCAACTTCTCTGACTACATCCGTGGAGGCATCGTCAG

TCAGGTCAAAGTACCGAAAAAGATTAGTTTT AAATCCTTGCCAGCATCACTGGTAGAGCCTGACTTTGTGATGACTGACTTTGCCAAGTATTCTCGCCC

TGCCCAACTGCACATTGGCTTCCAAGCTCTGCACCAATTCTGTGCTCTGCACAACCAACCACCTCGACCACGAAATGAG GAAGATGCAACAGAGCTGGT

GGGCCTGGCTCAGGCTGTAAACGCTCGGTCCCCACCTTCAGTAAAACAGAACAGCTTGGATGAAGACCTTATTCGGAAGCTAGCTTATGTTGCTGCTGGG

GACCTGGCACCCATAAATGCTTTCATTGGGGGCCTTGCTGCCCAGGAAGTCATGAAG GCCTGCTCTGGAAAGTTTATGCCCATCATGCAGTGGTTGTAC

TTTGATGCTCTTGAATGTCTCCCAGAGGACAAAGAGGCTCTGACAGAGGAGAAGTGCCTCCCA CGTCAGAACCGTTACGATGGGCAGGTAGCTGTATTT

GGGTCAGACTTTCAGGAGAAGCTGAGCAAGCAAAAGTACTTCCTG GTGGGTGCAGGGGCCATTGGCTGTGAATTGCTCAAGAACTTTGCCATGATTGGG

CTGGGTTGTGGAGAGGGTGGAGAGGTCGTGGTCACAGACATGGACACCATTGAGAAATCAAATCTGAACCGACAGTTTCTCTTCCGGCCCTGGGATGTCA

CG AAGTTAAAGTCTGACACGGCCGCTGCAGCTGTGCGCCAGATGAATCCTTACATCCAGGTGACAAGCCACCAGAACCGTGTAGGTCCTGACACTGAGC

GCATCTATGATGATGATTTCTTCCAAAATTTGGATGGTGTGGCCAATGCTCTGGACAACATAGATGCCC GCATGTACATGGATCGCCGATGTGTGTACT

ATCGGAAGCCACTGCTAGAGTCTGGCACACTGGGCACAAAGGGCAACGTGCAGGTGGTAATCCCCTTCCTGACAGAATCCTACAGCTCTAGCCAGGATCC

ACCAGAGAAATCCATCCCCATTTGTACCCTGAAAAACTTTCCCAATGCCATCGAACACACTCTTCAG TGGGCCCGGGATGAATTTGAAGGCCTTTTCAA

GCAGCCAGCAGAAAATGTTAATCAGTACCTCAC AGACTCCAAATTTGTGGAGCGGACATTGCGGCTGGCTGGTACCCAGCCATTGGAGGTGCTGGAGGC

TGTGCAGCGCAGCCTGGTGTTGCAGCGACCACAGACTTGGGGAGACTGTGTGACCTGGGCCTGCCACCACTGGCACACCCAGTACTGTAACAACATCCGG

CAACTGCTGCACAACTTTCCTCCTGACCAG CTCACCAGCTCAGGGGCCCCTTTCTGGTCTGGACCCAAACGCTGTCCACACCCACTTACTTTTGATGTT

AACAAT ACATTGCATCTGGATTATGTGATGGCTGCTGCCAACCTTTTTGCCCAGACCTATGGGTTGACTGGATCCCAAGACCGAGCTGCTGTGGCCTCA

CTCCTGCAGTCAGTACAAGTCCCAGAGTTCACCCCCAAGTCTGGTGTCAAGATTCATGTTTCTGACCAGGAGTTGCAGAGTGCCAATGCCTCTGTTG AT

GACAGCCGTCTTGAGGAGCTCAAAGCCACATTGCCCAGCCCAGACAAGTTACCCGGATTTAAGATGTACCCCATTGATTTTGAGAAG GATGATGACAGC

AATTTCCACATGGATTTCATTGTGGCTGCATCCAATCTTCGGGCCGAAAACTATGATATTTCCCCTGCAGACCGACACAAG AGCAAGCTGATTGCAGGG

AAGATCATCCCAGCCATTGCCACAACCACAGCTGCTGTGGTTGGCCTTGTGTGTCTGGAGCTCTACAAGGTAGTTCAAGGGCACCAACAGCTCGATTCCT

ACAAAAATGGTTTCCTGAACTTGGCCCTGCCCTTCTTTGGGTTTTCTGAACCTCTTGCTGCACCTCGTCACCAG TACTATAATCAAGAGTGGACATTGT

GGGATCGCTTTGAAGTACAAGGGCTGCAGCCTAATGGTGAGGAGATGACCCTCAAGCAGTTCCTTGATTACTTTAAG ACAGAGCACAAATTGGAGATCA

CCATGCTGTCCCAGGGCGTGTCCATGCTCTATTCTTTCTTCATGCCAGCTGCTAAGCTCAAGGAACGATTGGATCAGCC GATGACAGAGATTGTGAGCC

GAGTGTCAAAGAGAAAGCTGGGCCGCCATGTGCGGGCACTGGTGCTTGAGCTGTGCTGCAACGATGAAAGCGGCGAGGACGTCGAGGTCCCTTATGTCCG

ATATACCATTCGCTGATCTCCGTGCATTCCCCTAAGCCCCAGTCCTCCCTCCTCAGATCCTTTCCAATCCTGGTTTCCATTTGGCCTCAGGCAGTGGTCC

ATGTAGCCAAGCCTGGCCTTCCCTATTACCCAGCAACCTCAAGACCCTCTCACCGCTGCTTTGTACCTTGTTTGGAACCTAAATCCCAATAAAAGGATAA

TTACCCAGATGTAGCCATCCTGGCTGTCTCCAAGGAAGGAAGAAGTATGTCTAGAGTTCTCTGGTTCAAATAAGTACCCCAATGGGCTACTCCAGCTATA

AGCTTTCTGGGCAGAGAAAACTGGGAATTGATATCTTTTATATACTCTGCATAACAGACATGAGGTACCAGTGAAGTTATGCAGACCAGTACCTGGGTCA

ATATGATTTAAGTGACTTGAACTGGGTTCAAACTCTGTCTTCTCCATGATCACTACTAGCTGCCTCCATCCACTATGAAGAATACACTTAACAGTGATCA

GGTGGGGGCTGGAGAGACGGCTCAGCTCTTAAGAGCACTGACTGCTCTTCCAGGGGTCCTGAGTTCAATTCCCAGCAACCACATGGTGGCTCACAACCAT

CTGTAATGGTGGGTCTGAAGGGAGTGACAGTATACACACATACAATCAGTCAATCAATCAATAAAAACAGTGATCAGGCTGC
Translation
 - UNI36951 - MSSSPLSKKRRVSGPDPKPGSNCSPAQSALSEVSSVPTN GMAKNGSEADIDESLYSRQL LYVLGHEAMKMLQTSSVLVSGLRGL

GVEIAKNIILGGVKAVTLHDQGTTQWADLSSQ FYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSSFQ VVVLTNSPLEAQLRVGEFCHS

RGIKLVVADTRGLFG GQLFCDFGEEMVLTDSNGEQPLSAMVSMVTK DNPGVVTCLDEARHGFETGDFVSFSEVQGMIQLNGCQPMEIKVLG GPYTFS

ICDTSNFSDYIRGGIVSQVKVPKKISF KSLPASLVEPDFVMTDFAKYSRPAQLHIGFQALHQFCALHNQPPRPRNE EDATELVGLAQAVNARSPPSVK

QNSLDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMK ACSGKFMPIMQWLYFDALECLPEDKEALTEEKCLP RQNRYDGQVAVFGSDFQEKLSKQKYF

L VGAGAIGCELLKNFAMIGLGCGEGGEVVVTDMDTIEKSNLNRQFLFRPWDVT KLKSDTAAAAVRQMNPYIQVTSHQNRVGPDTERIYDDDFFQNLDG

VANALDNIDAR RMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQ WARDEFEGLFKQPAENVNQYL

T TDSKFVERTLRLAGTQPLEVLEAVQRSLVLQRPQTWGDCVTWACHHWHTQYCNNIRQLLHNFPPDQ LTSSGAPFWSGPKRCPHPLTFDVNN TLHLD

YVMAAANLFAQTYGLTGSQDRAAVASLLQSVQVPEFTPKSGVKIHVSDQELQSANASVD DDSRLEELKATLPSPDKLPGFKMYPIDFEK DDDSNFHMD

FIVAASNLRAENYDISPADRHK SKLIAGKIIPAIATTTAAVVGLVCLELYKVVQGHQQLDSYKNGFLNLALPFFGFSEPLAAPRHQ YYNQEWTLWDRF

EVQGLQPNGEEMTLKQFLDYFK TEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQP PMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRY

TIR
Transcript ENSMUST00000001989
Sequence
ATCTTGTGTCGGCTGCTGGGGTGAAGGAGGGTGGCAGGGAAGACCACAACCACCGCGGTCGGGGAAGGAGAAGGCGACAGTGATCCTAGCTGGCCCAGGC

GGCAGGAGGAGGAGGAGAAAGAGGAGGGTGGCGGCCGAGCTTGACTTCGGCTCCTTGAGGAGTTGGCGGCGGCACGACCCGGGGAACCGGCATTG ATGT

CCAGCTCGCCGCTGTCCAAGAAACGTCGCGTGTCCGGGCCTGATCCAAAGCCGGGTTCTAACTGCTCCCCTGCACAGTCTGCGCTGTCCGAAGTGTCCTC

AGTGCCAACCAAC GGAATGGCGAAGAACGGCAGTGAAGCAGACATAGACGAGAGCCTTTACTCCCGGCAGCT GTACGTTTTGGGCCATGAGGCAATGA

AAATGCTCCAGACATCCAGCGTCCTTGTCTCAGGCTTGCGGGGCTTGGGTGTAGAAATTGCTAAGAACATCATCCTTGGTGGGGTCAAGGCTGTCACCCT

ACATGACCAAGGAACTACCCAGTGGGCTGATCTCTCCTCCCAG TTTTACCTTCGGGAGGAGGACATTGGTAAAAATCGAGCGGAGGTATCCCAGCCCCG

ACTTGCTGAACTCAACAGCTATGTACCTGTCACTGCCTACACTGGGCCTCTTGTCGAGGACTTCCTTAGTAGCTTCCAG GTGGTGGTCCTCACCAACAG

CCCCCTGGAAGCCCAGCTGCGAGTGGGGGAGTTCTGTCATAGCCGTGGTATCAAGCTAGTGGTGGCAGATACAAGAGGCCTGTTTGG GCAACTTTTCTG

TGATTTTGGAGAGGAAATGGTCCTCACAGATTCCAATGGGGAGCAGCCACTCAGTGCTATGGTTTCAATGGTCACCAAG GACAACCCCGGTGTGGTTAC

CTGCCTTGATGAGGCCCGACATGGCTTTGAGACTGGTGACTTCGTCTCATTCTCAGAAGTACAGGGCATGATCCAACTCAATGGATGTCAGCCCATGGAG

ATCAAAGTGCTGG GTCCTTATACCTTTAGTATCTGTGACACTTCCAACTTCTCTGACTACATCCGTGGAGGCATCGTCAGTCAGGTCAAAGTACCGAAA

AAGATTAGTTTT AAATCCTTGCCAGCATCACTGGTAGAGCCTGACTTTGTGATGACTGACTTTGCCAAGTATTCTCGCCCTGCCCAACTGCACATTGGC

TTCCAAGCTCTGCACCAATTCTGTGCTCTGCACAACCAACCACCTCGACCACGAAATGAG GAAGATGCAACAGAGCTGGTGGGCCTGGCTCAGGCTGTA

AACGCTCGGTCCCCACCTTCAGTAAAACAGAACAGCTTGGATGAAGACCTTATTCGGAAGCTAGCTTATGTTGCTGCTGGGGACCTGGCACCCATAAATG

CTTTCATTGGGGGCCTTGCTGCCCAGGAAGTCATGAAG GCCTGCTCTGGAAAGTTTATGCCCATCATGCAGTGGTTGTACTTTGATGCTCTTGAATGTC

TCCCAGAGGACAAAGAGGCTCTGACAGAGGAGAAGTGCCTCCCA CGTCAGAACCGTTACGATGGGCAGGTAGCTGTATTTGGGTCAGACTTTCAGGAGA

AGCTGAGCAAGCAAAAGTACTTCCTG GTGGGTGCAGGGGCCATTGGCTGTGAATTGCTCAAGAACTTTGCCATGATTGGGCTGGGTTGTGGAGAGGGTG

GAGAGGTCGTGGTCACAGACATGGACACCATTGAGAAATCAAATCTGAACCGACAGTTTCTCTTCCGGCCCTGGGATGTCACG AAGTTAAAGTCTGACA

CGGCCGCTGCAGCTGTGCGCCAGATGAATCCTTACATCCAGGTGACAAGCCACCAGAACCGTGTAGGTCCTGACACTGAGCGCATCTATGATGATGATTT

CTTCCAAAATTTGGATGGTGTGGCCAATGCTCTGGACAACATAGATGCCC GCATGTACATGGATCGCCGATGTGTGTACTATCGGAAGCCACTGCTAGA

GTCTGGCACACTGGGCACAAAGGGCAACGTGCAGGTGGTAATCCCCTTCCTGACAGAATCCTACAGCTCTAGCCAGGATCCACCAGAGAAATCCATCCCC

ATTTGTACCCTGAAAAACTTTCCCAATGCCATCGAACACACTCTTCAG TGGGCCCGGGATGAATTTGAAGGCCTTTTCAAGCAGCCAGCAGAAAATGTT

AATCAGTACCTCAC AGACTCCAAATTTGTGGAGCGGACATTGCGGCTGGCTGGTACCCAGCCATTGGAGGTGCTGGAGGCTGTGCAGCGCAGCCTGGTG

TTGCAGCGACCACAGACTTGGGGAGACTGTGTGACCTGGGCCTGCCACCACTGGCACACCCAGTACTGTAACAACATCCGGCAACTGCTGCACAACTTTC

CTCCTGACCAG CTCACCAGCTCAGGGGCCCCTTTCTGGTCTGGACCCAAACGCTGTCCACACCCACTTACTTTTGATGTTAACAAT ACATTGCATCTG

GATTATGTGATGGCTGCTGCCAACCTTTTTGCCCAGACCTATGGGTTGACTGGATCCCAAGACCGAGCTGCTGTGGCCTCACTCCTGCAGTCAGTACAAG

TCCCAGAGTTCACCCCCAAGTCTGGTGTCAAGATTCATGTTTCTGACCAGGAGTTGCAGAGTGCCAATGCCTCTGTTG ATGACAGCCGTCTTGAGGAGC

TCAAAGCCACATTGCCCAGCCCAGACAAGTTACCCGGATTTAAGATGTACCCCATTGATTTTGAGAAG GATGATGACAGCAATTTCCACATGGATTTCA

TTGTGGCTGCATCCAATCTTCGGGCCGAAAACTATGATATTTCCCCTGCAGACCGACACAAG AGCAAGCTGATTGCAGGGAAGATCATCCCAGCCATTG

CCACAACCACAGCTGCTGTGGTTGGCCTTGTGTGTCTGGAGCTCTACAAGGTAGTTCAAGGGCACCAACAGCTCGATTCCTACAAAAATGGTTTCCTGAA

CTTGGCCCTGCCCTTCTTTGGGTTTTCTGAACCTCTTGCTGCACCTCGTCACCAG TACTATAATCAAGAGTGGACATTGTGGGATCGCTTTGAAGTACA

AGGGCTGCAGCCTAATGGTGAGGAGATGACCCTCAAGCAGTTCCTTGATTACTTTAAG ACAGAGCACAAATTGGAGATCACCATGCTGTCCCAGGGCGT

GTCCATGCTCTATTCTTTCTTCATGCCAGCTGCTAAGCTCAAGGAACGATTGGATCAGCC GATGACAGAGATTGTGAGCCGAGTGTCAAAGAGAAAGCT

GGGCCGCCATGTGCGGGCACTGGTGCTTGAGCTGTGCTGCAACGATGAAAGCGGCGAGGACGTCGAGGTCCCTTATGTCCGATATACCATTCGCTGATCT

CCGTGCATTCCCCTAAGCCCCAGTCCTCCCTCCTCAGATCCTTTCCAATCCTGGTTTCCATTTGGCCTCAGGCAGTGGTCCATGTAGCCAAGCCTGGCCT

TCCCTATTACCCAGCAACCTCAAGACCCTCTCACCGCTGCTTTGTACCTTGTTTGGAACCTAAATCCCAATAAAAGGATAATTACCC
Translation
 MSSSPLSKKRRVSGPDPKPGSNCSPAQSALSEVSSVPTN GMAKNGSEADIDESLYSRQL LYVLGHEAMKMLQTSSVLVSGLRGLGVEIAKNIILGGV

KAVTLHDQGTTQWADLSSQ FYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSSFQ VVVLTNSPLEAQLRVGEFCHSRGIKLVVADTRGL

FG GQLFCDFGEEMVLTDSNGEQPLSAMVSMVTK DNPGVVTCLDEARHGFETGDFVSFSEVQGMIQLNGCQPMEIKVLG GPYTFSICDTSNFSDYIRG

GIVSQVKVPKKISF KSLPASLVEPDFVMTDFAKYSRPAQLHIGFQALHQFCALHNQPPRPRNE EDATELVGLAQAVNARSPPSVKQNSLDEDLIRKLA

YVAAGDLAPINAFIGGLAAQEVMK ACSGKFMPIMQWLYFDALECLPEDKEALTEEKCLP RQNRYDGQVAVFGSDFQEKLSKQKYFL VGAGAIGCELL

KNFAMIGLGCGEGGEVVVTDMDTIEKSNLNRQFLFRPWDVT KLKSDTAAAAVRQMNPYIQVTSHQNRVGPDTERIYDDDFFQNLDGVANALDNIDAR R

MYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQ WARDEFEGLFKQPAENVNQYLT TDSKFVERTLR

LAGTQPLEVLEAVQRSLVLQRPQTWGDCVTWACHHWHTQYCNNIRQLLHNFPPDQ LTSSGAPFWSGPKRCPHPLTFDVNN TLHLDYVMAAANLFAQTY

GLTGSQDRAAVASLLQSVQVPEFTPKSGVKIHVSDQELQSANASVD DDSRLEELKATLPSPDKLPGFKMYPIDFEK DDDSNFHMDFIVAASNLRAENY

DISPADRHK SKLIAGKIIPAIATTTAAVVGLVCLELYKVVQGHQQLDSYKNGFLNLALPFFGFSEPLAAPRHQ YYNQEWTLWDRFEVQGLQPNGEEMT

LKQFLDYFK TEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQP PMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR

For any suggestions or comments, please send an email to unitrap@crg.es