Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001946 (Esam)
Chromosomal location
Chr 9: 37335698 - 37345891 (+)
Description
endothelial cell-specific adhesion molecule Gene [Source:MGI Symbol;Acc:MGI:1916774]
RefSeq_dna
NM_027102 
RefSeq_peptide
NP_081378.1 
UniGene
Mm.41751 
MGI
MGI:1916774 
Uniprot/SWISSPROT
Q925F2 
Uniprot/SPTREMBL
Q05CZ9 Q3U102 
Human Ortholog
ENSG00000149564 (ESAM)
Omim not available
UniTrap UNI13131
Vector Insertion
Chr 9: 37335876 - 37339072
Public Clones CMHD-GT_337B5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20220
Vector Insertion
Chr 9: 37339261 - 37341737
Public Clones IST13043A9 (tigm)
Private Clones OST369358 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000002011
Sequence
GGTCAGTAGCCTGGTTCCTGTGCACATTCGGGTTGCCGCCGCTCACCCACAACACCTGTAGACACCGTGTGTCCAACTCTCCCTGAGTACTCCGGGCCAA

GGAGGGCCATGATTCTTCAGGCTGGAACCCCCGAGACCAGCTTGCTGCGGGTTTTGTTCCTGGGACTGAGTACCCTTG - UNI13131 - CTGCCTTC

TCCCGAGCTCAGATGGAGTTGCACGTGCCCCCGGGCCTCAACAAATTGGAAGCGGTAGAGGGAGAAGAAGTGGTGCTCCCCGCCTGGTACACGATGGCAC

GGGAGGAGTCGTGGTCCCACCCCCGGGAGGTGCCCATCCTGATCTGGTTCTTGGAACAAGAAGGGAAGGAACCAAACCAG - UNI20220 - GTGTTG

TCTTACATTAATGGAGTCATGACAAATAAACCTGGAACAGCCCTGGTCCACTCTATCTCTTCACGGAATGTGTCCCTGCGCCTGGGGGCACTCCAGGAGG

GAGACTCTGGGACTTACCGCTGTTCTGTCAATGTGCAGAATGATGAAGGCAAAAGTATAGGCCACAGCATCAAAAGCATAGAGCTCAAAGTGCTGG TTC

CTCCAGCTCCTCCATCCTGTAGTTTACAGGGTGTACCCTATGTCGGGACCAATGTGACCCTGAACTGCAAGTCCCCAAGGAGTAAACCTACTGCTCAGTA

CCAGTGGGAGAGGCTGGCCCCATCCTCCCAGGTCTTCTTTGGACCAGCCTTAG ATGCTGTTCGTGGATCTTTAAAGCTCACTAACCTTTCCATTGCCAT

GTCTGGAGTCTATGTCTGCAAGGCTCAAAACAGAGTGGGCTTTGCCAAGTGCAACGTGACCTTGGACGTGATGACAG GGTCCAAGGCTGCAGTGGTCGC

TGGAGCAGTTGTGGGCACTTTTGTTGGGTTGGTGCTGATAGCTGGGCTGGTCCTGTTGTACCAGCGCCGGAGCAAGACCTTGGAAGAGCTGGCCAATGAT

ATCAA GGAAGATGCCATTGCTCCCCGGACCTTGCCTTGGACCAAAGGCTCAGACACAATCTCCAAGAATGGGACACTTTCTTCGGTCACCTCAGCACGA

GCTCTGCGGCCACCCAAGGCTGCTCCTCCAAGACCTGGCACATTTACTCCCACACCCAGTGTCTCTAGCCAGGCCCTGTCCTCACCAAGACTGCCCAGGG

TAGATGAACCCCCACCTCAGGCAGTGTCCCTGACCCCAGGTGGGGTTTCTTCTTCTGCTCTGAGCCGCATGGGTGCTGTGCCTGTGATGGTGCCTGCACA

GAGTCAGGCTGGGTCTCTTGTGTGATAGCCCAGGCACTCATTAGCTACATCTGGTATCTGACCTTTCTGTAAAGGTCTCCTTGTGGCACAGAGGACTCAA

TCTTGGGAGGATGCCCACATTCTAGACCTCCAGTCCTTTGCTCCTACCTCCTTCTATTGTTGGAATACTGGGCCTCAGTAAGACTAAAATCTGGGTCAAA

GGACAAAAGGAGGAAATGGACCTGAGGTAGGGGGTTGGGAGTGAGGAGGCTTCACTTCCTCCCTGCTTCTCCCTGAAGCCAGATGAATGCTGCGGAAGAT

CGGCTACCCTCCAAGGGCTCTGGAGGAGACTGCCAGTCAGTGATGCCCCTGGCTCTGTGATCTGTACAACACCCTTATCTAATGCTGTCCTTTGCCGTTC

GCTCCATCTCCCTGTATTAATATAACCTGTCCTGCTGGCTTGGCTGGGTTTTGTTGTAGCAGGGGGATAGGAAAGACATTTTAAAATCTGACTTGAAATT

GATGTTTTTGTTTTTATTTTGCAAATTTCAATAAAGATACATCGCATTT
Translation
MILQAGTPETSLLRVLFLGLSTLA - UNI13131 - AAFSRAQMELHVPPGLNKLEAVEGEEVVLPAWYTMAREESWSHPREVPILIWFLEQEGKEPN

Q - UNI20220 - VLSYINGVMTNKPGTALVHSISSRNVSLRLGALQEGDSGTYRCSVNVQNDEGKSIGHSIKSIELKVLV VPPAPPSCSLQGVPYV

GTNVTLNCKSPRSKPTAQYQWERLAPSSQVFFGPALD DAVRGSLKLTNLSIAMSGVYVCKAQNRVGFAKCNVTLDVMTG GSKAAVVAGAVVGTFVGLV

LIAGLVLLYQRRSKTLEELANDIK KEDAIAPRTLPWTKGSDTISKNGTLSSVTSARALRPPKAAPPRPGTFTPTPSVSSQALSSPRLPRVDEPPPQAVS

LTPGGVSSSALSRMGAVPVMVPAQSQAGSLV

For any suggestions or comments, please send an email to unitrap@crg.es