Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000001995 (AC073946.23-201)
Chromosomal location
Chr 8: 127941963 - 128016610 (-)
Description
Signal-induced proliferation-associated 1-like protein 2 (SIPA1-like protein 2) [Source:UniProtKB/Swiss-Prot;Acc:Q80TE4]
RefSeq_dna
NM_001081337 
RefSeq_peptide
NP_001074806.1 
UniGene
Mm.475032 Mm.271668 
Uniprot/SWISSPROT
Q80TE4 
Uniprot/SPTREMBL
Q5EBP0 
Human Ortholog
ENSG00000116991 (SIPA1L2)
Omim not available
UniTrap UNI30611
Vector Insertion
Chr 8: 127977200 - 127988327
Public Clones IST12680E7 (tigm) IST10190H8 (tigm) IST12680E7HMF1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38648
Vector Insertion
Chr 8: 127941962 - 127945863
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108775
Sequence
GTTTGGTGAAAAAGGCAACCACCTTTCTGTCTCTGTCTGTTACAGTGCTGTGTGACGACCATGGAGGGAGGCTCACACCACTACTGCTGATAACTGCTTC

CTGTTCCTGTGGACATGAGTGATCCAAGGCCGTCACAGGCAGAGAAGCACAAGCTTGGCAGAGCTGCTGCCAAACTCAAGGACCCTTCCAGAACCATGCA

GGCTGATGATTATTTTGCTCGGAAATTTAAAGCCATCAATGGCAGCATGGGACCTGCTACTTTAAACACTTCCAGTTCGAGTGAGGGCGGAGGAGGTGGG

GGTGGGCCAGCCAATGGTACCCCAGCAGTGCCCAAGATGGGTGTGAGGGCCAGAGTTTCTGAGTGGCCTCCTAAAAAGGACTGCTCCAAGGACCTGGCTT

GCAAGACGCTGTGGGAGAGTCGTTCTCAGTCCAGCTATGAGAGTGTTACCTCTATCATCCAGAATGGCCAAAATGACCAGGGTGACAGGCAGCCAGAGGA

GCAGCTGGACCTGGACTTTGTAGAAGCAAAGTACACCATTGGAGACATCTTTGTCCATTCTCCCCAGAGAGGGCTGCACCCCATACGACAGAGGAGCAAC

AGTGACATCACCATCAGTGATATCGATACGGAGGATGTCCTGGACCAACACGCAGTCAACCCCAACACGGGAGCGGCCCTGCACAGGGAGTATGGGAGCA

CTTCATCTATTGACAGGCAGGGTCTGTCTGGAGAGAATGTTTTCGCCATGCTCCGAGGGTACCGAATAGAGAGTTATGACCCTAAAGTGACTGGCTCCTT

TGGGTTTCCAGATTTCTTTCCCTGTGACACTGCCATCTCCCCCAGCCTCCATGCAGCAGCCCAGATTTCCAGAGGAGAATTTGTCCGCATCTCAGGGTTG

GACTACATGGATGGCGGCCTCTTGATGGGGAGGGACAGAGACAAGCCCTTCAAGCGCAGGCTAAAGTCAGAGTCTGTGGAAACCTCACTCTTCCGAAAAC

TTCGGGCAGTCAAGAGTGAGCATGAGACCTTCAAGTTCACGTCTGACCTGGAGGAGGGACGCCTGGACCGAGGCATCCGCCCATGGAGTTGCCAGAGGTG

CTTTGCCCATTACGATGTGCAGAGTATCCTGTTCAACATCAATGAAGCCATGGCCACGAGGGCCAGTGTAGGGAAGAGAAAGAACATCACCACGGGGGCC

TCCGCAGCATCACAGACCCCGGTTCCTGTAGGCCCAGCCGGAGGCTGCGAGTCCCCGCTGGGCAGTAAGGAGGACCTCAACTCCAAGGAGAACCCAGATG

CTGATGAGGGCGATGGGAAGAGCAACGACCTGGTCCTCAGCTGTCCATACTTTCGCAATGAGACTGGTGGGGAGGGCGATAGACGCATTGCCCTCTCTCG

GGCCAACTCAGCCTCTTTCAGCTCTGGGGAGAGCTGCTCCTTTGAGTCATCCCTCAGCTCACACTGTACCAATGCAGGTGTCTCTGTCTTGGAGGTGCCA

CGGGAGAGCCAGCCCATCCACAGGGAGAAGGTCAAACGCTACATCATAGAGCACGTCGACCTCGGGGCCTACTACTACCGCAAGTTCTTCTATGGCAAAG

 AGCACCAGAACTACTTTGGAATAGATGAAAATCTTGGCCCTGTGGCGGTCAGCATCCGGAGGGAGAAGGTGGAAGATCCCAGGGAGAAGGAAGGGTCGC

AGTTCAACTACAGGGTGGCCTTCAGGACAAGCGAG CTCACAACTCTGAGGGGAGCAATCCTAGAAGACGCTGTCCCCTCCACAGCTCGGCACGGCACCG

CCCGGGGCCTACCCCTCAAGGAAGTCCTGGAGTATGTTATCCCAGAACTGAGTATCCAGTGTCTGCGGCAAGCAGCCAACTCCCCCAAGGTCCCAGAGCA

GCTGCTCAAGCTGGATGAACAAGGG CTGAGCTTCCAGCACAAAATTGGGATCCTGTACTGCAGAGCTGGGCAGAGCACGGAGGAGGAGATGTACAACAA

CGAGACTGCAGGGCCGGCCTTCGAGGAGTTCCTGGACCTCCTCGGCCAGAGAGTGCGGCTGAAGGGTTTCAGCAAGTACCGTGCGCAGCTGGACAATAAG

A CGGATTCCACAGGGACTCACTCCCTCTATACCACATATAAAGACTTCGAACTCATGTTCCATGTGTCGACGCTGCTTCCATACATGCCAAACAACAGG

CAGCAG CTTCTGAGGAAGAGACACATCGGGAACGACATCGTCACCATTGTCTTCCAAGAGCCCGGCGCCCTCCCCTTCACCCCCAAGAACATTCGTTCA

CACTTCCAGCACGTCTTCGTCATAGTGAAGGTGCACAACCCCTGCACTGAAAACGTGTGCTACAG TGTTGGAGTCTCCAGGTCAAAGGATGTCCCTCCC

TTCGGTCCCCCAATCCCCAAAGGTGTAACTTTTCCAAAGTCAGCTGTCTTCCGGGACTTCCTTTTAGCCAAAGTGATCAATGCAGAAAATGCGGCCCATA

AGTCAGAGAAATTCCGGGCCATGGCTACCCGAACAAGGCAAGAATACTTGAAGGATTTAGCCGAGAACTTTGTCACAACCGCCACAGTGGACACTTCTGC

AAAATTCAGCTTCATCACGCTGGGGGCAAAGAAGAAAGAGCGGGTAAAGCCAAGGAAGGACGCGCACCTGTTCAGCATCGGGGCCATCATGTGGCACGTG

GTGGCACGGGACTTTGGCCAGTCCGCGGACATTGAGTGTCTCCTGGGGATCTCCAATGAGTTCATCATGCTGATCGAGAAGGATTCCAAGAATGTGGTGT

TTAACTGTTCCTGTAGGGACGTGATTGGCTGGACTTCAGGGCTAGTGAGCATCAAAGCCTTCTATGAAAGGGGAGAGTGCCTCCTGCTCTCCTCCGTGGA

TAACCGTTCTGAAGACATCCGAGAAATAGTGCAACGACTGCTA - UNI30611 - ATAGTAACAAGAGGCTGCGAGACTGTGGAAATGACCCTGAGAC

GAAACGGGCTGGGTCAGCTTGGCTTCCATGTGAACTTTGAAGGAATTGTTGCCGATGTGGAACCTTTCGGCTTTGCCTGGAAGGCAGGCCTTCGCCAAGG

GAGCCGGCTTGTGGAGATCTGCAAGGTGGCTGTGGCCACGCTGACCCACGAGCAGATGATTGACTTACTGCGGACATCTGTGACTGTGAAAGTAGTTATC

ATCCAGCCCCACGAGGATGGCTCTCCCCGCAG - UNI30611 - GGGCTGTTCAGAGCTCTGCCGGATCCCCATGGTGGAATACAAGCTGGACAGCGA

GGGCACACCCTGTGAGTACAAGACACCTTTTAGGAGGAACACCACGTGGCACCGTGTGCCCACCCCTGCCCTACAGCCAGTTTCCAGAGCCTCACCTGTG

CCTGGCACACCTGACCGACTCCAGTGCCAGCCGCTGCTGCAGCAGGCCCAGGCCGCCATCCCCCGGAGCACATCCTTTGATAGGAAGCTGCCTGATGGCA

CCAG - UNI30611 - AAGTTCTCCCAGCAACCAGTCATCATCTAGCGACCCAGGACCTGGTGGGAGCGGACCCTGGCGGCCACAAGTGGGCTACGAT

GG GTGCCCATCACCCCTCCTGCTGGAGCACCAGGGCCCAGGCTCTGTGGAGTGCGATGGAACCGGGGAGCAGGAGGACCTCTTGGAGGGAGGCAGGCTT

CCAG AAACCAAATGGCATGGCCCACCTTCCAAGGTCCTGAGCTCCTATAAGGAAAGAGTGCTGCAGAAAGACGGAAGCTGCAAAGAGTCCCCCAATAAG

CTATCTCAT ATTGGGGATAAGAGCTGCTCCAGCCACTCCAGCAGCAACACTCTGTCTAGTAACACCTCCAGCAACAGTGATGACAAGCACTTTGGGTCA

GGGGACCTGATGGACCCCGAGCTGCTGGGACTGACCTACATCAAAGGCGCGTCCACCGACAGCGGCATCGACACCACGCCGTGCATGCCAGCCACCATCC

TTGGCCCAGTGCATCTGACAGGCAGCAGGTCCCTGATGCACAGCCGGGCTGAGCAGTGGGCAGATGCTGCTGATGTCTCGGTAGCTGACGATGACCCTGC

CAAGATGTATGCCCTGCATGGCTATGCCTCTGCCATCTCCAGCAGCGCTGCTGACGGTAGCATGGGTGACCTCAGTGAGGTCTCCTCCCACTCCAG TGG

CTCGCAGCACTCAGGAAGCCCTTCAGCTCACTGCTCCAAAAGCACCGGCTCTCTGGACAGTTCCAAAGTCTACATTGTCACTCACGGCGGCGGTCAGCAG

GCACCTGGGGCGGTGACAAAGCCTTACCACAGACAAGGAGCAGCAAACAAATATGTCATTGGCTGGAAAAAGTCAGAAGGTAGCCCACCACCCGAGGAAC

CTGAAGTGACGGAATGCCCCAG GATATATGGTGAGATGGACATCATGTCCACAGCCACTCAGCACCCGGCAGTGGTGGGAGACTCTGTTTCAGAAACTC

AGCATGTCCTATCCAAAGATGACTTTCTGAAGTTGATGCTGCCGGACAGCCCCTTAGTGGAGGAGGGGAGACGGAAG TTTTCGTTCTACGGGAACGTGT

CTCCACGGAGGTCGCTGTACCGAACACTGTCCGATGAGAGCGTGTGCAGCAACCGGAGGGGCTCTTCCTTTGCCAGCTCACGAAGCTCCATCCTAGAGCA

GGCACTGCCCAACGACATTCTGTTTAGCACGACCCCACCCTACCACAGTACGCTGCCTCCAAGAACCCACCCTGCACCCAGCATGGGGAGCCTACGGA A

TGAGTTCTGGTTCTCGGATGGGTCCTTATCAGACAAGTCCAAGTGTGCAGATCCTGGCCTGATGCCGCTGCCAGACACAGCTGCAGGGTTAGACTGGTCC

CACCTCGTGGATGCTGCACGAGCATTTGAAG GTCTTGACTCAGATGAAGAACTCGGGCTTCTCTGTCACCACGCCTCCTACCTAG ACCAGAGGGTAGC

CTCCTTCTGTACCCTGACCGACCTCCAGCATGGACAAGAACTAGAAGGGGCCCCAGAGCTGTCCTTGTGTGTAGATCCCACCAGTGGCAAAGAGTTCATG

GATACACCTGG GGAGCGATCGCCCTCCACACTGACTGGGAAAGTTAACCAGCTAGAACTGATTCTCCGACAACTGCAGACTGACCTTCGGAAG GAGAA

GCAGGACAAGGCGGTGCTGCAGGCTGAGGTCCAGCACCTGAGGCAGGACAACATGCGGCTGCAGGAAGAGTCACAGACAGCCACAGCCCAGCTGCGCAAG

TTCACCGAGTGGTTTTTTAGCACCATTGACAAGAAGGCCTGATCAGCTCGCTGCTCCTCACCTTGGGACCACGGGCTGGTCGGCCTGCCTGCCTGCCACC

CTGCCTACCCGTGGTCCCTTCCAAGTCAGCAAAGCAGTTTTTACATGTGCTTTCCATCACCTGTAGGTAGATGTCTCACTGTCTGTCTGTGTCTCTACTC

ACCCCAGCAGGCAGGTCAGGGGCCTGGACTCCCGCATAGCTGCAGCAGAAGATGAATGTAACTGCTGGTGGATGCTGACAGCCTGTAGCCGAGTGGTTTC

CCTGACGATGCTCGGGTCTCCTTCCTGTGGGGAGAGAACCTAGGCAGGTGACCTGCAGAGATGCTAAGCCAGTGGACTATGGCAGGGCTGTAGGGCTGTA

AAATAACTATGGAGACGAGAATCAGACATGTACTTTAATGTTAAAGGTGCTCTATTTTTCGGATGTACAGTAGTTTTATTTCCACAGCCGCATTATCATA

GCAATAAGAAGGGCACGCAGTAGGCGGTCTGCAGAGCTCTGTCAGAGACGGACCCTGAAGTTTAACACTAGCACGAACGCTGTTGCTGTAGAGACGTATT

TATTTGCAGGAACAAACGGTGCCTGAATATTAACAGTGTTCTGAATTTTTTTTAAAAGAGATGCATATGCCTTGTGAACGGCTGGACCTGTCAGTAGTCA

CTCCTGCGCGCGTAGTTTGCTTTCTTGTAGTTGCTCTGCTGCAGTCAGTCAGTCTACCCTCCCCGATAGAGCCCCCGATGCTGAGTGCCAGCAGGATCCT

GTGTCCGACACCAGATCTGTTTATCTTTGTACAGAACCTCTGATAAAGTGTCTTGTATTTAACACTCTTATTTAAGCTTATTTAACCCTAACTTGTTAAT

TTTATATGATTTTTGTTTCACCTGCGCTAGCTGTAAGGCGGGAGGCAGGCAGGCAGTGACTGAGCTCACCTGGACCTGACTGAAGCAGGTGGGCGAGCTG

AGGACCGGATGCTGCTGGCTAACACGTTGTTTGTATTGCTTCTCCATTTTTAACTGTTATATTTGAGATGAACATACATTTTGCTTTTTTAATAAATGTT

CAAAAGAAGTCAACATCAGAAGCA
Translation
MSDPRPSQAEKHKLGRAAAKLKDPSRTMQADDYFARKFKAINGSMGPATLNTSSSSEGGGGGGGPANGTPAVPKMGVRARVSEWPPKKDCSKDLACKTLW

ESRSQSSYESVTSIIQNGQNDQGDRQPEEQLDLDFVEAKYTIGDIFVHSPQRGLHPIRQRSNSDITISDIDTEDVLDQHAVNPNTGAALHREYGSTSSID

RQGLSGENVFAMLRGYRIESYDPKVTGSFGFPDFFPCDTAISPSLHAAAQISRGEFVRISGLDYMDGGLLMGRDRDKPFKRRLKSESVETSLFRKLRAVK

SEHETFKFTSDLEEGRLDRGIRPWSCQRCFAHYDVQSILFNINEAMATRASVGKRKNITTGASAASQTPVPVGPAGGCESPLGSKEDLNSKENPDADEGD

GKSNDLVLSCPYFRNETGGEGDRRIALSRANSASFSSGESCSFESSLSSHCTNAGVSVLEVPRESQPIHREKVKRYIIEHVDLGAYYYRKFFYGKE EHQ

NYFGIDENLGPVAVSIRREKVEDPREKEGSQFNYRVAFRTSE LTTLRGAILEDAVPSTARHGTARGLPLKEVLEYVIPELSIQCLRQAANSPKVPEQLL

KLDEQG LSFQHKIGILYCRAGQSTEEEMYNNETAGPAFEEFLDLLGQRVRLKGFSKYRAQLDNKT TDSTGTHSLYTTYKDFELMFHVSTLLPYMPNNR

QQ LLRKRHIGNDIVTIVFQEPGALPFTPKNIRSHFQHVFVIVKVHNPCTENVCYS SVGVSRSKDVPPFGPPIPKGVTFPKSAVFRDFLLAKVINAENA

AHKSEKFRAMATRTRQEYLKDLAENFVTTATVDTSAKFSFITLGAKKKERVKPRKDAHLFSIGAIMWHVVARDFGQSADIECLLGISNEFIMLIEKDSKN

VVFNCSCRDVIGWTSGLVSIKAFYERGECLLLSSVDNRSEDIREIVQRLL - UNI30611 - IVTRGCETVEMTLRRNGLGQLGFHVNFEGIVADVEP

FGFAWKAGLRQGSRLVEICKVAVATLTHEQMIDLLRTSVTVKVVIIQPHEDGSPRR - UNI30611 - RGCSELCRIPMVEYKLDSEGTPCEYKTPFR

RNTTWHRVPTPALQPVSRASPVPGTPDRLQCQPLLQQAQAAIPRSTSFDRKLPDGTR - UNI30611 - RSSPSNQSSSSDPGPGGSGPWRPQVGYDG

 GCPSPLLLEHQGPGSVECDGTGEQEDLLEGGRLPE ETKWHGPPSKVLSSYKERVLQKDGSCKESPNKLSH IGDKSCSSHSSSNTLSSNTSSNSDDKH

FGSGDLMDPELLGLTYIKGASTDSGIDTTPCMPATILGPVHLTGSRSLMHSRAEQWADAADVSVADDDPAKMYALHGYASAISSSAADGSMGDLSEVSSH

SS SGSQHSGSPSAHCSKSTGSLDSSKVYIVTHGGGQQAPGAVTKPYHRQGAANKYVIGWKKSEGSPPPEEPEVTECPR RIYGEMDIMSTATQHPAVVG

DSVSETQHVLSKDDFLKLMLPDSPLVEEGRRK FSFYGNVSPRRSLYRTLSDESVCSNRRGSSFASSRSSILEQALPNDILFSTTPPYHSTLPPRTHPAP

SMGSLRN NEFWFSDGSLSDKSKCADPGLMPLPDTAAGLDWSHLVDAARAFEG GLDSDEELGLLCHHASYLD DQRVASFCTLTDLQHGQELEGAPELS

LCVDPTSGKEFMDTPG GERSPSTLTGKVNQLELILRQLQTDLRK EKQDKAVLQAEVQHLRQDNMRLQEESQTATAQLRKFTEWFFSTIDKKA
Transcript ENSMUST00000047850
Sequence
GTTTGGTGAAAAAGGCAACCACCTTTCTGTCTCTGTCTGTTACAGTGCTGTGTGACGACCATGGAGGGAGGCTCACACCACTACTGCTGATAACTGCTTC

CTGTTCCTGTGGACATGAGTGATCCAAGGCCGTCACAGGCAGAGAAGCACAAGCTTGGCAGAGCTGCTGCCAAACTCAAGGACCCTTCCAGAACCATGCA

GGCTGATGATTATTTTGCTCGGAAATTTAAAGCCATCAATGGCAGCATGGGACCTGCTACTTTAAACACTTCCAGTTCGAGTGAGGGCGGAGGAGGTGGG

GGTGGGCCAGCCAATGGTACCCCAGCAGTGCCCAAGATGGGTGTGAGGGCCAGAGTTTCTGAGTGGCCTCCTAAAAAGGACTGCTCCAAGGACCTGGCTT

GCAAGACGCTGTGGGAGAGTCGTTCTCAGTCCAGCTATGAGAGTGTTACCTCTATCATCCAGAATGGCCAAAATGACCAGGGTGACAGGCAGCCAGAGGA

GCAGCTGGACCTGGACTTTGTAGAAGCAAAGTACACCATTGGAGACATCTTTGTCCATTCTCCCCAGAGAGGGCTGCACCCCATACGACAGAGGAGCAAC

AGTGACATCACCATCAGTGATATCGATACGGAGGATGTCCTGGACCAACACGCAGTCAACCCCAACACGGGAGCGGCCCTGCACAGGGAGTATGGGAGCA

CTTCATCTATTGACAGGCAGGGTCTGTCTGGAGAGAATGTTTTCGCCATGCTCCGAGGGTACCGAATAGAGAGTTATGACCCTAAAGTGACTGGCTCCTT

TGGGTTTCCAGATTTCTTTCCCTGTGACACTGCCATCTCCCCCAGCCTCCATGCAGCAGCCCAGATTTCCAGAGGAGAATTTGTCCGCATCTCAGGGTTG

GACTACATGGATGGCGGCCTCTTGATGGGGAGGGACAGAGACAAGCCCTTCAAGCGCAGGCTAAAGTCAGAGTCTGTGGAAACCTCACTCTTCCGAAAAC

TTCGGGCAGTCAAGAGTGAGCATGAGACCTTCAAGTTCACGTCTGACCTGGAGGAGGGACGCCTGGACCGAGGCATCCGCCCATGGAGTTGCCAGAGGTG

CTTTGCCCATTACGATGTGCAGAGTATCCTGTTCAACATCAATGAAGCCATGGCCACGAGGGCCAGTGTAGGGAAGAGAAAGAACATCACCACGGGGGCC

TCCGCAGCATCACAGACCCCGGTTCCTGTAGGCCCAGCCGGAGGCTGCGAGTCCCCGCTGGGCAGTAAGGAGGACCTCAACTCCAAGGAGAACCCAGATG

CTGATGAGGGCGATGGGAAGAGCAACGACCTGGTCCTCAGCTGTCCATACTTTCGCAATGAGACTGGTGGGGAGGGCGATAGACGCATTGCCCTCTCTCG

GGCCAACTCAGCCTCTTTCAGCTCTGGGGAGAGCTGCTCCTTTGAGTCATCCCTCAGCTCACACTGTACCAATGCAGGTGTCTCTGTCTTGGAGGTGCCA

CGGGAGAGCCAGCCCATCCACAGGGAGAAGGTCAAACGCTACATCATAGAGCACGTCGACCTCGGGGCCTACTACTACCGCAAGTTCTTCTATGGCAAAG

 AGCACCAGAACTACTTTGGAATAGATGAAAATCTTGGCCCTGTGGCGGTCAGCATCCGGAGGGAGAAGGTGGAAGATCCCAGGGAGAAGGAAGGGTCGC

AGTTCAACTACAGGGTGGCCTTCAGGACAAGCGAG CTCACAACTCTGAGGGGAGCAATCCTAGAAGACGCTGTCCCCTCCACAGCTCGGCACGGCACCG

CCCGGGGCCTACCCCTCAAGGAAGTCCTGGAGTATGTTATCCCAGAACTGAGTATCCAGTGTCTGCGGCAAGCAGCCAACTCCCCCAAGGTCCCAGAGCA

GCTGCTCAAGCTGGATGAACAAGGG CTGAGCTTCCAGCACAAAATTGGGATCCTGTACTGCAGAGCTGGGCAGAGCACGGAGGAGGAGATGTACAACAA

CGAGACTGCAGGGCCGGCCTTCGAGGAGTTCCTGGACCTCCTCGGCCAGAGAGTGCGGCTGAAGGGTTTCAGCAAGTACCGTGCGCAGCTGGACAATAAG

A CGGATTCCACAGGGACTCACTCCCTCTATACCACATATAAAGACTTCGAACTCATGTTCCATGTGTCGACGCTGCTTCCATACATGCCAAACAACAGG

CAGCAG CTTCTGAGGAAGAGACACATCGGGAACGACATCGTCACCATTGTCTTCCAAGAGCCCGGCGCCCTCCCCTTCACCCCCAAGAACATTCGTTCA

CACTTCCAGCACGTCTTCGTCATAGTGAAGGTGCACAACCCCTGCACTGAAAACGTGTGCTACAG TGTTGGAGTCTCCAGGTCAAAGGATGTCCCTCCC

TTCGGTCCCCCAATCCCCAAAGGTGTAACTTTTCCAAAGTCAGCTGTCTTCCGGGACTTCCTTTTAGCCAAAGTGATCAATGCAGAAAATGCGGCCCATA

AGTCAGAGAAATTCCGGGCCATGGCTACCCGAACAAGGCAAGAATACTTGAAGGATTTAGCCGAGAACTTTGTCACAACCGCCACAGTGGACACTTCTGC

AAAATTCAGCTTCATCACGCTGGGGGCAAAGAAGAAAGAGCGGGTAAAGCCAAGGAAGGACGCGCACCTGTTCAGCATCGGGGCCATCATGTGGCACGTG

GTGGCACGGGACTTTGGCCAGTCCGCGGACATTGAGTGTCTCCTGGGGATCTCCAATGAGTTCATCATGCTGATCGAGAAGGATTCCAAGAATGTGGTGT

TTAACTGTTCCTGTAGGGACGTGATTGGCTGGACTTCAGGGCTAGTGAGCATCAAAGCCTTCTATGAAAGGGGAGAGTGCCTCCTGCTCTCCTCCGTGGA

TAACCGTTCTGAAGACATCCGAGAAATAGTGCAACGACTGCTA - UNI30611 - ATAGTAACAAGAGGCTGCGAGACTGTGGAAATGACCCTGAGAC

GAAACGGGCTGGGTCAGCTTGGCTTCCATGTGAACTTTGAAGGAATTGTTGCCGATGTGGAACCTTTCGGCTTTGCCTGGAAGGCAGGCCTTCGCCAAGG

GAGCCGGCTTGTGGAGATCTGCAAGGTGGCTGTGGCCACGCTGACCCACGAGCAGATGATTGACTTACTGCGGACATCTGTGACTGTGAAAGTAGTTATC

ATCCAGCCCCACGAGGATGGCTCTCCCCGCAG - UNI30611 - GGGCTGTTCAGAGCTCTGCCGGATCCCCATGGTGGAATACAAGCTGGACAGCGA

GGGCACACCCTGTGAGTACAAGACACCTTTTAGGAGGAACACCACGTGGCACCGTGTGCCCACCCCTGCCCTACAGCCAGTTTCCAGAGCCTCACCTGTG

CCTGGCACACCTGACCGACTCCAGTGCCAGCCGCTGCTGCAGCAGGCCCAGGCCGCCATCCCCCGGAGCACATCCTTTGATAGGAAGCTGCCTGATGGCA

CCAG - UNI30611 - AAGTTCTCCCAGCAACCAGTCATCATCTAGCGACCCAGGACCTGGTGGGAGCGGACCCTGGCGGCCACAAGTGGGCTACGAT

GG GTGCCCATCACCCCTCCTGCTGGAGCACCAGGGCCCAGGCTCTGTGGAGTGCGATGGAACCGGGGAGCAGGAGGACCTCTTGGAGGGAGGCAGGCTT

CCAG AAACCAAATGGCATGGCCCACCTTCCAAGGTCCTGAGCTCCTATAAGGAAAGAGTGCTGCAGAAAGACGGAAGCTGCAAAGAGTCCCCCAATAAG

CTATCTCAT ATTGGGGATAAGAGCTGCTCCAGCCACTCCAGCAGCAACACTCTGTCTAGTAACACCTCCAGCAACAGTGATGACAAGCACTTTGGGTCA

GGGGACCTGATGGACCCCGAGCTGCTGGGACTGACCTACATCAAAGGCGCGTCCACCGACAGCGGCATCGACACCACGCCGTGCATGCCAGCCACCATCC

TTGGCCCAGTGCATCTGACAGGCAGCAGGTCCCTGATGCACAGCCGGGCTGAGCAGTGGGCAGATGCTGCTGATGTCTCGGTAGCTGACGATGACCCTGC

CAAGATGTATGCCCTGCATGGCTATGCCTCTGCCATCTCCAGCAGCGCTGCTGACGGTAGCATGGGTGACCTCAGTGAGGTCTCCTCCCACTCCAG TGG

CTCGCAGCACTCAGGAAGCCCTTCAGCTCACTGCTCCAAAAGCACCGGCTCTCTGGACAGTTCCAAAGTCTACATTGTCACTCACGGCGGCGGTCAGCAG

GCACCTGGGGCGGTGACAAAGCCTTACCACAGACAAGGAGCAGCAAACAAATATGTCATTGGCTGGAAAAAGTCAGAAGGTAGCCCACCACCCGAGGAAC

CTGAAGTGACGGAATGCCCCAG GATATATGGTGAGATGGACATCATGTCCACAGCCACTCAGCACCCGGCAGTGGTGGGAGACTCTGTTTCAGAAACTC

AGCATGTCCTATCCAAAGATGACTTTCTGAAGTTGATGCTGCCGGACAGCCCCTTAGTGGAGGAGGGGAGACGGAAG TTTTCGTTCTACGGGAACGTGT

CTCCACGGAGGTCGCTGTACCGAACACTGTCCGATGAGAGCGTGTGCAGCAACCGGAGGGGCTCTTCCTTTGCCAGCTCACGAAGCTCCATCCTAGAGCA

GGCACTGCCCAACGACATTCTGTTTAGCACGACCCCACCCTACCACAGTACGCTGCCTCCAAGAACCCACCCTGCACCCAGCATGGGGAGCCTACGGA A

TGAGTTCTGGTTCTCGGATGGGTCCTTATCAGACAAGTCCAAGTGTGCAGATCCTGGCCTGATGCCGCTGCCAGACACAGCTGCAGGGTTAGACTGGTCC

CACCTCGTGGATGCTGCACGAGCATTTG ACCAGAGGGTAGCCTCCTTCTGTACCCTGACCGACCTCCAGCATGGACAAGAACTAGAAGGGGCCCCAGAG

CTGTCCTTGTGTGTAGATCCCACCAGTGGCAAAGAGTTCATGGATACACCTGG GGAGCGATCGCCCTCCACACTGACTGGGAAAGTTAACCAGCTAGAA

CTGATTCTCCGACAACTGCAGACTGACCTTCGGAAG GAGAAGCAGGACAAGGCGGTGCTGCAGGCTGAGGTCCAGCACCTGAGGCAGGACAACATGCGG

CTGCAGGAAGAGTCACAGACAGCCACAGCCCAGCTGCGCAAGTTCACCGAGTGGTTTTTTAGCACCATTGACAAGAAGGCCTGATCAGCTCGCTGCTCCT

CACCTTGGGACCACGGGCTGGTCGGCCTGCCTGCCTGCCACCCTGCCTACCCGTGGTCCCTTCCAAGTCAGCAAAGCAGTTTTTACATGTGCTTTCCATC

ACCTGTAGGTAGATGTCTCACTGTCTGTCTGTGTCTCTACTCACCCCAGCAGGCAGGTCAGGGGCCTGGACTCCCGCATAGCTGCAGCAGAAGATGAATG

TAACTGCTGGTGGATGCTGACAGCCTGTAGCCGAGTGGTTTCCCTGACGATGCTCGGGTCTCCTTCCTGTGGGGAGAGAACCTAGGCAGGTGACCTGCAG

AGATGCTAAGCCAGTGGACTATGGCAGGGCTGTAGGGCTGTAAAATAACTATGGAGACGAGAATCAGACATGTACTTTAATGTTAAAGGTGCTCTATTTT

TCGGATGTACAGTAGTTTTATTTCCACAGCCGCATTATCATAGCAATAAGAAGGGCACGCAGTAGGCGGTCTGCAGAGCTCTGTCAGAGACGGACCCTGA

AGTTTAACACTAGCACGAACGCTGTTGCTGTAGAGACGTATTTATTTGCAGGAACAAACGGTGCCTGAATATTAACAGTGTTCTGAATTTTTTTTAAAAG

AGATGCATATGCCTTGTGAACGGCTGGACCTGTCAGTAGTCACTCCTGCGCGCGTAGTTTGCTTTCTTGTAGTTGCTCTGCTGCAGTCAGTCAGTCTACC

CTCCCCGATAGAGCCCCCGATGCTGAGTGCCAGCAGGATCCTGTGTCCGACACCAGATCTGTTTATCTTTGTACAGAACCTCTGATAAAGTGTCTTGTAT

TTAACACTCTTATTTAAGCTTATTTAACCCTAACTTGTTAATTTTATATGATTTTTGTTTCACCTGCGCTAGCTGTAAGGCGGGAGGCAGGCAGGCAGTG

ACTGAGCTCACCTGGACCTGACTGAAGCAGGTGGGCGAGCTGAGGACCGGATGCTGCTGGCTAACACGTTGTTTGTATTGCTTCTCCATTTTTAACTGTT

ATATTTGAGATGAACATACATTTTGCTTTTTTAATAAATGTTCAAAAGAAGTCAACATCAGAAGCA
Translation
MSDPRPSQAEKHKLGRAAAKLKDPSRTMQADDYFARKFKAINGSMGPATLNTSSSSEGGGGGGGPANGTPAVPKMGVRARVSEWPPKKDCSKDLACKTLW

ESRSQSSYESVTSIIQNGQNDQGDRQPEEQLDLDFVEAKYTIGDIFVHSPQRGLHPIRQRSNSDITISDIDTEDVLDQHAVNPNTGAALHREYGSTSSID

RQGLSGENVFAMLRGYRIESYDPKVTGSFGFPDFFPCDTAISPSLHAAAQISRGEFVRISGLDYMDGGLLMGRDRDKPFKRRLKSESVETSLFRKLRAVK

SEHETFKFTSDLEEGRLDRGIRPWSCQRCFAHYDVQSILFNINEAMATRASVGKRKNITTGASAASQTPVPVGPAGGCESPLGSKEDLNSKENPDADEGD

GKSNDLVLSCPYFRNETGGEGDRRIALSRANSASFSSGESCSFESSLSSHCTNAGVSVLEVPRESQPIHREKVKRYIIEHVDLGAYYYRKFFYGKE EHQ

NYFGIDENLGPVAVSIRREKVEDPREKEGSQFNYRVAFRTSE LTTLRGAILEDAVPSTARHGTARGLPLKEVLEYVIPELSIQCLRQAANSPKVPEQLL

KLDEQG LSFQHKIGILYCRAGQSTEEEMYNNETAGPAFEEFLDLLGQRVRLKGFSKYRAQLDNKT TDSTGTHSLYTTYKDFELMFHVSTLLPYMPNNR

QQ LLRKRHIGNDIVTIVFQEPGALPFTPKNIRSHFQHVFVIVKVHNPCTENVCYS SVGVSRSKDVPPFGPPIPKGVTFPKSAVFRDFLLAKVINAENA

AHKSEKFRAMATRTRQEYLKDLAENFVTTATVDTSAKFSFITLGAKKKERVKPRKDAHLFSIGAIMWHVVARDFGQSADIECLLGISNEFIMLIEKDSKN

VVFNCSCRDVIGWTSGLVSIKAFYERGECLLLSSVDNRSEDIREIVQRLL - UNI30611 - IVTRGCETVEMTLRRNGLGQLGFHVNFEGIVADVEP

FGFAWKAGLRQGSRLVEICKVAVATLTHEQMIDLLRTSVTVKVVIIQPHEDGSPRR - UNI30611 - RGCSELCRIPMVEYKLDSEGTPCEYKTPFR

RNTTWHRVPTPALQPVSRASPVPGTPDRLQCQPLLQQAQAAIPRSTSFDRKLPDGTR - UNI30611 - RSSPSNQSSSSDPGPGGSGPWRPQVGYDG

 GCPSPLLLEHQGPGSVECDGTGEQEDLLEGGRLPE ETKWHGPPSKVLSSYKERVLQKDGSCKESPNKLSH IGDKSCSSHSSSNTLSSNTSSNSDDKH

FGSGDLMDPELLGLTYIKGASTDSGIDTTPCMPATILGPVHLTGSRSLMHSRAEQWADAADVSVADDDPAKMYALHGYASAISSSAADGSMGDLSEVSSH

SS SGSQHSGSPSAHCSKSTGSLDSSKVYIVTHGGGQQAPGAVTKPYHRQGAANKYVIGWKKSEGSPPPEEPEVTECPR RIYGEMDIMSTATQHPAVVG

DSVSETQHVLSKDDFLKLMLPDSPLVEEGRRK FSFYGNVSPRRSLYRTLSDESVCSNRRGSSFASSRSSILEQALPNDILFSTTPPYHSTLPPRTHPAP

SMGSLRN NEFWFSDGSLSDKSKCADPGLMPLPDTAAGLDWSHLVDAARAFD DQRVASFCTLTDLQHGQELEGAPELSLCVDPTSGKEFMDTPG GERS

PSTLTGKVNQLELILRQLQTDLRK EKQDKAVLQAEVQHLRQDNMRLQEESQTATAQLRKFTEWFFSTIDKKA

For any suggestions or comments, please send an email to unitrap@crg.es