Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002103 (Acp2)
Chromosomal location
Chr 2: 91043076 - 91053295 (+)
Description
acid phosphatase 2, lysosomal Gene [Source:MGI (curated);Acc:Acp2-001]
RefSeq_dna
NM_007387 
RefSeq_peptide
NP_031413.1 
UniGene
Mm.45570 
MGI
MGI:87882 
Uniprot/SWISSPROT
P24638 
Uniprot/SPTREMBL
Q3UZN1 A2AGR5 Q3U4F3 
Human Ortholog
ENSG00000134575 (ACP2)
Omim 200950 - ACID PHOSPHATASE DEFICIENCY  
UniTrap UNI35199
Vector Insertion
Chr 2: 91043206 - 91043757
Public Clones IST14478C12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22928
Vector Insertion
Chr 2: 91043854 - 91044396
Public Clones not available
Private Clones OST281012 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099722
Sequence
ACAGCCTACAACAGTGATGGCCGGCAGACAGACTGGTTGGAGCCAGGCGGCTCTTCTCCAGTTCCTTCTTGGCATGTGCCTAACGGTGATGCCACCCATA

CAGGCCCGGAGTCTACGCTTTGTTACCTTG CTGTATCGACATGGAGATCGGTCACCAGTGAAGACATATCCCAAGGACCCCTATCAGGAAGAGAAATGG

CCCCAGGGATTTGGTCAGCTAACCAAG - UNI22928 - GAAGGGATGCTACAGCACTGGGAGCTGGGCCAGGCCCTGCGGCAACGCTACCATGGCTT

TCTGAACACCTCTTACCACAGGCAAGAG GTTTATGTGCGAAGCACAGACTTCGATCGTACTCTCATGAGTGCTGAGGCCAACCTGGCTGGACTCTTCCC

TCCCAATGAAGTTCAGCACTTCAACCCTAACATTTCATGGCAGCCTATCCCTGTTCACACTGTGCCCATCACTGAAGACAGG TTGCTGAAGTTTCCTTT

GGGTCCATGTCCCCGTTATGAGCAGCTGCAGAATGAGACTCGGCAGACACCAGAGTATCAGAACAGAAGTATTCAGAATGCA CAATTTCTGAACATGGT

GGCCAACGAGACAGGGCTTACAAACGTGACCCTAGAGACCATCTGGAATGTGTATGACACACTCTTTTGTGAG CAAACCCATGGGCTGCTTCTGCCGCC

CTGGGCCTCACCCCAAACCGTGCAGCGTCTGAGCCAGCTAAAGGACTTCAGCTTCCTCTTCCTCTTCGGGATCCACGAGCAAGTACAGAAGGCCCGGCTT

CAGGGGG GAGTTCTGCTGGCTCAGATATTGAAGAACCTGACCCTAATGGCAACTACCTCTCAATTCCCTAAGCTTCTGGTTTATTCCGCG CATGACAC

TACCCTGGTTGCTCTGCAAATGGCATTGAATGTCTACAATGGGAAGCAAGCTCCCTATGCTTCCTGCCACATATTTGAACTGTACCAGGAAGATAATGG 

GAATTTCTCAGTCGAGATGTACTTTCGGAATGACAGTAAGAAGGCACCCTGGCCTCTGATCCTGCCTGGCTGTCCTCACCGTTGCCCACTGCAGGATTTC

CTTCGCCTCACAGAGCCTGTCATACCCAAGGACTGGCAGAAGGAGTGCCAGCTAGCAAATGATACTGCAGACACAG AG GACTTGAGATGCAGACAAGC

ATTCAGATTTCACTCAAGACCTGGGACTAAAAAACAAAACAACAAAACCCCCATGAAAACCTGA
Translation
MAGRQTGWSQAALLQFLLGMCLTVMPPIQARSLRFVTL LYRHGDRSPVKTYPKDPYQEEKWPQGFGQLTK - UNI22928 - EGMLQHWELGQALRQ

RYHGFLNTSYHRQE VYVRSTDFDRTLMSAEANLAGLFPPNEVQHFNPNISWQPIPVHTVPITEDR LLKFPLGPCPRYEQLQNETRQTPEYQNRSIQNA

 QFLNMVANETGLTNVTLETIWNVYDTLFCE QTHGLLLPPWASPQTVQRLSQLKDFSFLFLFGIHEQVQKARLQGG GVLLAQILKNLTLMATTSQFPK

LLVYSA HDTTLVALQMALNVYNGKQAPYASCHIFELYQEDNG GNFSVEMYFRNDSKKAPWPLILPGCPHRCPLQDFLRLTEPVIPKDWQKECQLANDT

ADTE E DLRCRQAFRFHSRPGTKKQNNKTPMKT
Transcript ENSMUST00000002172
Sequence
ACAGCCTACAACAGTGATGGCCGGCAGACAGACTGGTTGGAGCCAGGCGGCTCTTCTCCAGTTCCTTCTTGGCATGTGCCTAACGGTGATGCCACCCATA

CAGGCCCGGAGTCTACGCTTTGTTACCTTG CTGTATCGACATGGAGATCGGTCACCAGTGAAGACATATCCCAAGGACCCCTATCAGGAAGAGAAATGG

CCCCAGGGATTTGGTCAGCTAACCAAG - UNI22928 - GAAGGGATGCTACAGCACTGGGAGCTGGGCCAGGCCCTGCGGCAACGCTACCATGGCTT

TCTGAACACCTCTTACCACAGGCAAGAG GTTTATGTGCGAAGCACAGACTTCGATCGTACTCTCATGAGTGCTGAGGCCAACCTGGCTGGACTCTTCCC

TCCCAATGAAGTTCAGCACTTCAACCCTAACATTTCATGGCAGCCTATCCCTGTTCACACTGTGCCCATCACTGAAGACAGG TTGCTGAAGTTTCCTTT

GGGTCCATGTCCCCGTTATGAGCAGCTGCAGAATGAGACTCGGCAGACACCAGAGTATCAGAACAGAAGTATTCAGAATGCA CAATTTCTGAACATGGT

GGCCAACGAGACAGGGCTTACAAACGTGACCCTAGAGACCATCTGGAATGTGTATGACACACTCTTTTGTGAG CAAACCCATGGGCTGCTTCTGCCGCC

CTGGGCCTCACCCCAAACCGTGCAGCGTCTGAGCCAGCTAAAGGACTTCAGCTTCCTCTTCCTCTTCGGGATCCACGAGCAAGTACAGAAGGCCCGGCTT

CAGGGGG GAGTTCTGCTGGCTCAGATATTGAAGAACCTGACCCTAATGGCAACTACCTCTCAATTCCCTAAGCTTCTGGTTTATTCCGCG CATGACAC

TACCCTGGTTGCTCTGCAAATGGCATTGAATGTCTACAATGGGAAGCAAGCTCCCTATGCTTCCTGCCACATATTTGAACTGTACCAGGAAGATAATGG 

GAATTTCTCAGTCGAGATGTACTTTCGGAATGACAGTAAGAAGGCACCCTGGCCTCTGATCCTGCCTGGCTGTCCTCACCGTTGCCCACTGCAGGATTTC

CTTCGCCTCACAGAGCCTGTCATACCCAAGGACTGGCAGAAGGAGTGCCAGCTAGCAAATGATACTGCAGACACAG AGGTAATTGTGGCATTGGCTGTC

TGTGGCTCCATCCTCTTCCTTCTCATAGTGTTGCTCCTCACCATCCTCTTCCGGATGCAGGCCCAGCCTCCTGGCTACCACCATGTTGCAGACAGGGAAG

ACCATGCTTGACAACCACTCAGTCCCCTTCCCTCTGCCTCCTAGGGGAGGTGGGCTGAGTCCTCGCTCCTGACCATTGCTGATCCCAGCCCAGGGACAGG

GTTAGCCTTCCTGATTACCTACGCCCAAATGAATGAGTGAGGCTCGGCTGGGTGTGCGGCACCTGGGGCTCACCATCTTCATGCCTGATGTTTACCGTGT

ACTGTGTTGGACACTGGCTTTCTCTAAATGGGATTTGCCTCTTCTATATTCCCTAAGGACTTGAGATGCAGACAAGCATTCAGATTTCACTCAAGACCTG

GGACTAAAAAACAAAACAACAAAACCCCCATGAAAACCTGAAGAAGCTGGTACTTGATCTGCCTTGCTCTTCCACCGAGCCTTGCTCTTTATCTTCTAGC

CCATATCTTTGGCAAATGGCTTGGAGGACATTGTCCCTTGGTACTTTTTTAGAGGCAAAAACTGCAAATCACTAGGAGTATAAAATATGGCTATCAAGAA

CTCGGGTCATCCAACAGCAAAGTCATCCTTTGGCTGAGGCTACCGTCAGTGTCAACCACAGGCAGGTCTGAAGGATACTTGGGCTGTACCTGGATGACAG

TGGGAGGACACAGGTAGGAGTGAAACACATGGAATCATGAGGTGACTCTCCTCAGCTGGGCTGGACTCTTCAGGGACCGTACACCTTGACCGTGGCCCCA

AATAGGGCTGAAGTAGCTCCGAGGAAATGAAGGTTTTGACTGTGAGTGCTGGTTCTGTGCCTTTTTTCCCTTCCCCATTTCTGACATCCAAGAAGCACTC

TTACCAGGTCAGTACTAGATCTACTCAGAAACCCTGTTGGGCTTTTGGGTTTTTAGTTAGATACAAAGGATATGCTTTTATTGGCCATGCTAAAATTGAA

CATAAAAGTTTTAAAATTCTCTGGTTATTTTGCTCCTATACATCAGAAAAAAGAAAAGTACCTTGGCTCTAGCATAAACTTGGCCTCCAGGCTAGATATA

GCTGGGACCCTGAGCGTAGCTGGTTTACTCTTTAATTTTCTGGAGCAAAATCTAGAGCAGTAACATGTCAGCATCCTAGTCCCACAGTATCCCTTGTCAC

AAGTGTCCCTGCTCCAACCCTAAGAATTGGGTACTTTTGGCCTATTAACAAACAGCTGCCACTCCTCACAGAATGTGTTCCCATCTGTGGGGTCCAGTAT

TGCTGTCCCACACCATCTTCATAGTCTTTCATGATCTTTCTGTGACCCATCTTCCTCTTGGCTCCAAATGAGAATATGATAACCTAGAAGAAACAAGAAG

TCTGAATGACACCTTCTGTTGCTGGTCTGTCTCAGAGGTTGGGGCTGTCTTGGGGAACTAACAGACTGACATTGCCATGACTAAAATAAAACCAGATGGG

TGACCTAGGCCAGATACCACTGTCTCCAAGATATATTTACTGCCCACTGCCCTGGGACGAATAGGGCAGAGCTACGGTGAATTCAGCCTCCACTGCAGCC

TCGGATAGGGCCAGGCTTAGACAGTTTGAGATACAGTTGCTTTTACTCACCCATAGTAGAGGCCAGTGTGTCTCCCATAGGATTGAACTCATTGAGCTAC

AAAAGTAAGAGTATCGGTGTGAAGCTGGGTTGAAGGCAGTACAGAGGCAGTAAATGGGGACTACTTCTAATGAGAAATTCCCTGCTTCCTCCCATCACTG

TTTGGGGGCCCAAGTCTCACCGAAGTAATACCGGAGTATCCTGGATCATAGAGCTGACACATCATCTTCCCTGAGCTTCCATCAAACACATCTATTGTCC

TTAGTTCATAGGGAACACAACTTTTAAGATTAGGATCTGGGTATCGGCCCACAACAATGAGGTTGTGCCGTGAATGCCAGGTCGCCTAGGAAACAGAGAG

GTCAGTCAGAATTTAAAGTATTTTTTGGAGTTAGGGACGAGGACTTGGTTGGTATAAGTACACTTGAGTTTGGATCCCCAGCATTCCTATACAAATCTTG

TCCTGATGCACCTGAATTCCAGCTGGGGGTGGAGACAGGATGCCCAGAACTTGCTAGCTATCTACTCCAGCCAAATCAGTGGGTTCCAGGTACAGTGAGA

AACCGTTTCAAAAATAAGATGGAGAACAACTGAGAAAGACACCTGCTGTCAACCTCTAGCCTTCACACACAAAGTATTTTTTAAGGGCTGGATATCCAGT

TCTGTGGCAGAGCACCTATATAGCATACACAAGGCTGTATGTTTGATCGCAGAATCTCACACACAGGCCAGCCTGGTCTGCACAGAAACCCTGTCTTGAA

AAAACAAAAGTCTGAACAAGGATAATGGGAAAACATTTGTTAAGAGCCAGAGGTGTTAAGTGGTAAAGATCTTACTTAGCATGCACAAGTGTTCAGTCCC

CAGAATTGC
Translation
MAGRQTGWSQAALLQFLLGMCLTVMPPIQARSLRFVTL LYRHGDRSPVKTYPKDPYQEEKWPQGFGQLTK - UNI22928 - EGMLQHWELGQALRQ

RYHGFLNTSYHRQE VYVRSTDFDRTLMSAEANLAGLFPPNEVQHFNPNISWQPIPVHTVPITEDR LLKFPLGPCPRYEQLQNETRQTPEYQNRSIQNA

 QFLNMVANETGLTNVTLETIWNVYDTLFCE QTHGLLLPPWASPQTVQRLSQLKDFSFLFLFGIHEQVQKARLQGG GVLLAQILKNLTLMATTSQFPK

LLVYSA HDTTLVALQMALNVYNGKQAPYASCHIFELYQEDNG GNFSVEMYFRNDSKKAPWPLILPGCPHRCPLQDFLRLTEPVIPKDWQKECQLANDT

ADTE EVIVALAVCGSILFLLIVLLLTILFRMQAQPPGYHHVADREDHA

For any suggestions or comments, please send an email to unitrap@crg.es