Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002221 (Paxip1)
Chromosomal location
Chr 5: 28067207 - 28117879 (-)
Description
PAX interacting (with transcription-activation domain) protein 1 Gene [Source:MGI Symbol;Acc:MGI:1890430]
RefSeq_dna
NM_018878 
RefSeq_peptide
NP_061366.2 
UniGene
Mm.277190 Mm.409895 
MGI
MGI:1890430 
Uniprot/SWISSPROT
Q6NZQ4 
Human Ortholog
ENSG00000157212 (PAXIP1)
Omim not available
UniTrap UNI8655
Vector Insertion
Chr 5: 28115318 - 28117738
Public Clones RRK210 (baygenomics) W051F06 (ggtc) W051F05 (ggtc)
Private Clones OST194105 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8185
Vector Insertion
Chr 5: 28110314 - 28115182
Public Clones RRF296 (baygenomics) RRH211 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9858
Vector Insertion
Chr 5: 28092831 - 28098543
Public Clones XB472 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18393
Vector Insertion
Chr 5: 28088213 - 28091677
Public Clones IST11853G11 (tigm)
Private Clones OST424206 (lexicon)
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18383
Vector Insertion
Chr 5: 28075455 - 28077502
Public Clones not available
Private Clones OST424309 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000002291
Sequence
CGACGCTGGGCGCGGCGGGCCGGGTGACGCGGGGCCGGGCGCCGCCGCGCCGCCGCGATCATGTCGGAGCCGGCGCCCGAAGTTCCAGAGGAGCTATTCC

GCGAGGTCAAGTACTACGCGGTGGGCGACATCGACCCGCAG - UNI8655 - GTTATTCAGCTCCTTAAAGCTGGGAAAGCCAAGGAAGTCTCCTACA

ATGCCCTGGCCTCACACATCATTTCAGAGGATGGGGACAACCCAGAGGTGGGAGAAGCCCGTGAGGTCTTTGACTTGCCCGTTGTAAAG - UNI8185 

- CCTTCCTGGGTGACTCTGTCCGTGCAATGTGGCGCTCTCCTGCC AGTCAATGGTTTCTCTCCAGAGTCCTGTCAGATTTTTTTTGGACTCACTGCCT

GCCTTTCTCAG GTGTCATCTGAAGACAGAAGTGCCCTGTGGGCCTTGGTTACGTTCCACGGGGGCAGTTGCCAACTAAACCTTAACAAGAAGTGCACAC

ACTTGATTGTCCCAGAGCCAAAGGGG GAGAAATACGAGCGTGCTGTCAAAAGAACAAGTATTAAGATTGTCACCCCGGACTGGGTCCTGGACTGTGTGT

CTGAGAAGAGGAGGAAGGATGAAGCGTTTTACCATCCACGCCTGATCATCTATGAGGAGGAGGAAGAGGAGGAGGAAGAGGGAGACAACGAGGAGCAGGA

CTCCCAGAACGAGGGCAGCACTGAGAAGTCCAGTGTCGCCAGCTCTGCAGTGGCCTCCCCTGCTGAGCAGCCGTGCTCTCCCAAGCCCAGGGCTGAGGTG

TCCAAAGGAGAGTTGATGTTTGATGACTCTTCTGACTCATCCCCTGAAAAGCAGGAGCGCAGCTTGAACTGGGCCCCTGCTGAAGCCCCACCACTCAACA

CAGCCCAGCGCAGGCTGCCTCAGGGAAAAGGGCCAGGACTCATTAACCTGTGTGCCAATGTCCCACCTGTTCCAGGGGACATTCTGCCTCCTGACATGCG

GGGTAACTTGATGGCCCCTGGACAAAACCTCCAGAATTCTGAGCGGTCAGAAATACTAGGGACCTGGAGCCCAGCTGTCCGGACGTTGCGAAACATTACA

AACAATGCTGATATCCAGCAGATCAACCGGCCATCCAATGTTGCACAT - UNI9858 - ATCTTACAATCCCTTTCAGCACCCACAAAAAGCCTAGAG

CAGCAGGTGGCCCGTGGCCAGCAGGGACACCCCAATGCCAGTGCTGTGCTGTTTGGCCAGGCTAAAGGTGCTCCCGAGACACACGTGTTGCAGCAGCACC

ACCCTCCCCAGCAGCCTCAGCAGCAGCACCCAGCCCTGCACCTCCAGCCCCAGATCATGCAGCTCCAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGCA

GCAGCCCCAGCCCTACCCCCAGCCTCCATCACATCAGTTCCCGCAGCAAGTCCATCAGCATCAGTTCTCTCAGCAGCAGCTCCAGTTTCCACAGCAACCA

TTACACCCTCAGCAGCAGTTGCATCGTCCTCAACAGCAGCTGCAGCCATTTCAGCAGCAGCATGCCCTGCAGCAGCAGCTTCATCAGTTGCAGCAGCAGC

AGCTCCAGCACCACCAGTTAGCACAGCTCCAGCAACAGCAGCAACAGCAGCACAACCTTCTCCAGCAGCAGCAACAACAGCAGCAGCTCCAACGCTTGCA

GCAGCAGCAGCAGATGCAGAATCAAGCAGCACACTTGAGCCAAGCGTCCCAGGCACTACAGCACCAGGTTCTACCCCAGCAGCCCCTGCAGCTGTCCCTG

CAGCCCCCACCTCAGCAACAGCAGCAGCAGCAGCTTTTTGGACATGACCCAGCAGTGGAGA TTCCAGAAGAAAGCTTCTTGCTAGGATGTGTGTTTGCA

ATTGCGGACTATCCCGAGCAGATGTCGGATAAGCAGCTGCTGGCCACCTGGAAAAGG - UNI18393 - ATAATCCAGGCACATGGTGGCACTGTGGA

CCCCACTTTCACAAGCCGATGTACACACCTCCTCTGCGCAAGTCAAGTCAGTAGTATGTACACACAG GCACTACGGGAGAGAAAGCGGTGTGTCACTGC

ACACTGGCTCAACACAGTGCTGAAGAAGAAGAAGCTGATGCCCCCTCATCGAGCCCTGCATTTCCCGGTGGCGTTCCCACCTGGGGGCAAACCCTGTTCA

CAGCAT ATTATCTCTGTGACTGGATTTGTTGACAATGACAGAGATGACCTGAAGTTAATGGCATACCTGGCAGGTGCCAAGTACACAGGGTACCTGTGC

CGTAGCAACACAGTCCTCATCTGTAAAGA ACCAAGCGGCTTGAAGTATGAAAAGGCCAAAGAGTGGAGGATCCCATGTGTGAATGCACAGTGGCTGGGG

GACATTCTGCTGGGGAACTTTGAGGCCCTGCGGCAAGTGCAGTACAGCCGGTACACCGCCTTCAACATGCCGGACCCCTTCGTTCCCACTCCACACTTGG

TCTTGGGTCTTCTAG ATGCATGGAGGACCCCAGTGAAGGTGACTGCAGAGCTGTTGATG GGTGTAAGATTACCTCCTAAGCTGAAACCAAATGAGGTC

GCTAACATCCAGCCTTCTTCTAAAAGAGCCAG AATTGAAGACTTGCCACCTCCCACTAAGAAGCTGACTCCAGAGCTGACGCCTTTAGTGCTCTTCACT

GGGTTTGAGCCTGTTCAAGTTCAGCAGTACATTAAG AAGCTGTACATTCTTGGTGGGGAAGTTGCTGAGTGCACGAAGAAGTGTACCCACCTCATTGCC

AGCAAGGTGACACGCACAGTGAAATTCTTGACGGCCATCTCTGTAGTAAAGCACATTGTGACTCCGGACTGGCTGGAGGAGTGCTTCAAGCGCCAGACAT

TTATCG - UNI18383 - ATGAGCAGAACTACATCCTTCGAGATGCTGAGGCAGAAGTGCTCTTCTCTTTCAGTCTGGAAGAGTCCTTAAAGCGAGCC

CATGTCTCTCCCCTCTTTAAG ACAAAGTATTTCTATATCACCCCTGGCATCTGCCCAAGCCTTGCAACTATGAAGGCAATTGTAGAGTGTGCAGGGGGA

AAGGTGCTAGCCAAGCAGCCGTCCTTCCGGAAGCTCATGGAGCACAAGCAGAATAAG AGTCTTTCAGAGATCATTTTAATATCCTGTGAGAACGACCTG

CACTTATGTCGCGAGTACTTTGCCAGGGGAATAG ATGTTCACAATGCGGAGTTTGTCCTGACTGGAGTACTCACACAGACACTGGACTATGAATC ATA

TAAATTTAACTGATGGCCTCTTGCTGCTGCTAGCCTGGAGCCTGGAGCACAAGGGTAGCTGCTGGCAGCATGAACCAGGACTCCCTCCCCGCAGAGGGCT

TGTTTTCCAGCTCTGCCTTAGGGAGAGACCTCGACCAGGAAGACAGATGTAATACTGACTGCATCGTGTTAAGATGTGTGATCTTATTCTAGGAAACATA

AATTATGTTTTGTATTATATGCCTAAGAGCCCACATTAAGTCTTCTGATTAATTTGCCAGGTTTTTAATGTGTTTTCAGAAAGCTGTGTGAAATTTCATC

TACAAATAAAAATGATGTAAATAAGACTTTGCTGTCTAAATTATGGCTGTTAAAGATATGAAATGTTTTGTACTTTGATTATTTTTATTTCTTACACTTT

TCTTTTATATTGATAACTTGCTCACAGTTAAATAAATGTACTTTTGAACTTAGAATTGGGTGATTATTTAAAATTTCATATTCTTTGCATAACATAAATG

ATTTTCAACAAGCTGGATAGCATTTTGATAAATTTCACAGCAGAGTATTTTTGAAGTAACTTTTCTCCTGGAGAAATAAGTTTTGATAGTATTTCATAAA

TAGTCACCTCTTACTGATATGGCAAGGGGGCTCCAGACAGGTGGACTGGAAGCCTGGACAGCCACTAAATGCAAACTGTGAGCCTGTTCCCAGCCTGGGC

AGAGCCTACCCTACTGTACTGATGTTGTACTCCAAAGCATGGTGGGGACAGTGCTCTGTTCTACGGGAAGGCCCGGTGTCTTTTGCCTACATGTTTCCTG

GCTAGCCCTGATCTCTGGTGACTTTGCATAGGACTGTTACTATCTGCAGAAACATCCTTCTGTTGGACATTCCTTGTGGCAGGTGTGTCTTCACAGGCTG

CTTTGGAGAGGCTGTCTAAGCAACCTGAGAGACTTCCTACAGAGCTGGCCTTTATCTGGTTGAAGTTGTCACTATGAAATACTTCCAAATGTGGAAATTG

GGGTGAGCAGAAGAAGAGCTCTGTACGTGGGGACAGTCGGATTTGCCAGCATGCCACATGCCATCCTGTGTCCTTGATCCTAGAACAAAGTGGATGTAGA

TTCAATAGCCTTCTCTGTGGAATGTCACACATCTGTTACCTGTGCAGGAGACAGGATGTTTCTTTAAGAGAGATATGACTGATTTTTTTTTTTTTCTGGT

TTTTCGAGACAGGGTTTCTCTGTGTAGCTCTGGCTGTCCTGGAACTCACTTTGTAGACCAGGCTGGCCTCGAACTCAGAAATCCACCTGCCTCTGCCTCT

CAAGTGCTGGGATTAAAGGCGTGGGCCACCACGCCCAGCTTGATTTTTTTTTTTATTTATGTGTATGAGTACTCTGTTGCTGTCTTCAGACACTCCAGAA

GAGGGCATCCAATTCCAATTCCATTACAGATGGTAATGAGCCACCATGTGGTTGCTGGGAATTGAACTCAGGACCTCTGGAAGAGCAGTCAGCGCTCTTC

CAGCCCTTGATTAACCTTTCAATTAGCATCTTCTGTAAGCTGCCAAGAAATGCAACTTGAGGAGCTGTCCAGAACCACAGCTTACACAGCTGTTCCACCC

GAGGTTGGCTGGGAGGGCAAGGTGACAAACAAATGCTGGTTATGAAGTAAATCAGAAAGGTGGTGGTTTCAAAAATGGTGCACATCTGGAGTGCCAACAG

TCGAATGCTGAGATACAGTGTTCTACATGGCAGACCCTGGGCTATCCAGGGCTACATGGGTGAGATCCTGTCTCAAAAAGTAAATAATTATATTTTGCCC

ACATTGTTTAAAATACAGTTAACTCTTTTCTGGT
Translation
MSEPAPEVPEELFREVKYYAVGDIDPQ - UNI8655 - VIQLLKAGKAKEVSYNALASHIISEDGDNPEVGEAREVFDLPVVK - UNI8185 - PS

WVTLSVQCGALLP PVNGFSPESCQIFFGLTACLSQ VSSEDRSALWALVTFHGGSCQLNLNKKCTHLIVPEPKG EKYERAVKRTSIKIVTPDWVLDCV

SEKRRKDEAFYHPRLIIYEEEEEEEEEGDNEEQDSQNEGSTEKSSVASSAVASPAEQPCSPKPRAEVSKGELMFDDSSDSSPEKQERSLNWAPAEAPPLN

TAQRRLPQGKGPGLINLCANVPPVPGDILPPDMRGNLMAPGQNLQNSERSEILGTWSPAVRTLRNITNNADIQQINRPSNVAH - UNI9858 - ILQS

LSAPTKSLEQQVARGQQGHPNASAVLFGQAKGAPETHVLQQHHPPQQPQQQHPALHLQPQIMQLQQQQQQQQQQQQQPQPYPQPPSHQFPQQVHQHQFSQ

QQLQFPQQPLHPQQQLHRPQQQLQPFQQQHALQQQLHQLQQQQLQHHQLAQLQQQQQQQHNLLQQQQQQQQLQRLQQQQQMQNQAAHLSQASQALQHQVL

PQQPLQLSLQPPPQQQQQQQLFGHDPAVEI IPEESFLLGCVFAIADYPEQMSDKQLLATWKR - UNI18393 - IIQAHGGTVDPTFTSRCTHLLCA

SQVSSMYTQ ALRERKRCVTAHWLNTVLKKKKLMPPHRALHFPVAFPPGGKPCSQH IISVTGFVDNDRDDLKLMAYLAGAKYTGYLCRSNTVLICKE E

PSGLKYEKAKEWRIPCVNAQWLGDILLGNFEALRQVQYSRYTAFNMPDPFVPTPHLVLGLLD DAWRTPVKVTAELLM GVRLPPKLKPNEVANIQPSSK

RAR RIEDLPPPTKKLTPELTPLVLFTGFEPVQVQQYIK KLYILGGEVAECTKKCTHLIASKVTRTVKFLTAISVVKHIVTPDWLEECFKRQTFID - 

UNI18383 - DEQNYILRDAEAEVLFSFSLEESLKRAHVSPLFK TKYFYITPGICPSLATMKAIVECAGGKVLAKQPSFRKLMEHKQNK SLSEIILI

SCENDLHLCREYFARGID DVHNAEFVLTGVLTQTLDYES SYKFN

For any suggestions or comments, please send an email to unitrap@crg.es