Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002227 (Mov10)
Chromosomal location
Chr 3: 104597754 - 104621481 (-)
Description
Moloney leukemia virus 10 Gene [Source:MGI (curated);Acc:Mov10-002]
RefSeq_dna
NM_008619 
RefSeq_peptide
NP_032645.1 
UniGene
Mm.406408 Mm.458278 
MGI
MGI:97054 
Uniprot/SWISSPROT
P23249 
Uniprot/SPTREMBL
Q3TFC0 Q3UD86 Q69ZE2 
Human Ortholog
ENSG00000155363 (MOV10)
Omim not available
UniTrap UNI37965
Vector Insertion
Chr 3: 104620853 - 104621075
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13516
Vector Insertion
Chr 3: 104608026 - 104620853
Public Clones (sanger) E066C08 (ggtc) D175G05 (ggtc) E066C05 (ggtc) D187E05 (ggtc)
CMHD-GT_303A7-3 (cmhd) CMHD-GT_429A1-3 (cmhd) CMHD-GT_476B3-3 (cmhd) CMHD-GT_404G2-3 (cmhd)
IST12479G3 (tigm) IST12276E7 (tigm) IST12265G9 (tigm) IST12710F5 (tigm)
IST12786C10 (tigm) IST11775E7 (tigm) IST14168G10 (tigm) IST12786B9 (tigm)
IST11398F11 (tigm) IST10878E4 (tigm) IST10030G7 (tigm) IST10886G4 (tigm)
IST10502E1 (tigm) IST11972A8 (tigm) IST14865A3 (tigm) IST10368E7 (tigm)
IST12892H8 (tigm)
Private Clones OST284197 (lexicon) OST243889 (lexicon) OST242766 (lexicon) OST232324 (lexicon)
OST202223 (lexicon) OST66125 (lexicon) OST56890 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37298
Vector Insertion
Chr 3: 104607632 - 104607821
Public Clones CMHD-GT_259C12-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22663
Vector Insertion
Chr 3: 104607395 - 104607632
Public Clones not available
Private Clones OST288656 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9110
Vector Insertion
Chr 3: 104598904 - 104599684
Public Clones XK542 (baygenomics) XF129 (baygenomics) CMHD-GT_338G5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13215
Vector Insertion
Chr 3: 104598365 - 104598611
Public Clones CMHD-GT_345D2-3 (cmhd)
Private Clones OST416977 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106775
Sequence
GCTGGACGAGCGGCCCCAGTCCAGCTGCAGCCGACCCATGTCCGGGGCTCTGCCCTTTGCTCTGCAGCTTTTCTATGTCCCGAGGCTCTGGAGAGTGGGC

GTGGGAGTAGCCCTAGCTGAGGCTCCAAGGTCCTCCGGGCTGTTTAGGGGGCCCCAGGCGATATCCACGTTCGGATCCTGGCTCGCTGCCAGGGGAGGGA

GCTCGGG TTTCATTTCCGCGGACCCTCCTGCCTGGGCCGCAGCCGCCGCCGCCGCGATGCCTAGCAAGTTCAGCTGCCGAAAGCTCCGGGAGACCGGCC

AGAGGTTCGAGAGTTTTCTGGCCGAACGTGGACTGGACCTGGAGACAGATCGTGAGCGGCTGCGGACGATTTACAACCACGACTTCAAGCCCAG - UNI

13516 - CTATGGGACCCCTGCCCCTGGCTTCTCCTCCATGCTGTATGGAATGAAGATCGCAAATCTGGCCTTCGTCACCAAGACTCGGGTCAGGTTCT

TCAAACTAGACCGCTGGGCTGATGTGCAGTTACCAGAAAAGAGGCGAATAAAGCCAGGGTCGAACATCAGCAAACAACACAGATCACTGTTGGCCAGGAT

CTTTCACGACAG - UNI22663 - GGCTGAGTACCTTCATGGGAAGCATGGGGTAGACGTGGAGGTCCAGGGGCCCCATGAAGCCCGAGACGGGCAAC

TCCTTATCCACCTGGATTTGAACCGCAAGGAGGTACTAACCCTACGGCTTCGGAACGGCGGAAGCAAACCTGTCACCCTCACTCACCTATTCCCACTGTG

CTGGACGCCCCAGTTTGTCTTCTACCATGGAGAACAGGACCTGCCCTGCCCACTGGGCCCCGGTGAGTG CTATGAACTCCACATCTACTGTAAGACCAG

CATTGTGGGTTACTTCCCAGCCACTGTCCTCTGGGAACTCCTGGGACCCGGGGAGTCGGGAGCAGAAGGAGCAGAAACTTTCTACATTGCCCGATTCCTG

GCGGCTGTCGCCCACAGTCCCCTGGCTGCCCAGTTGAAACCCACAACTCCCTTCAAACGCCCCCCTCGGCTCACCAGAAACTCTGTGTTGACCAACCGGA

TCGAGGAAGGAGAGAGGCCCGACCG AGCCAAGGGCTATGAACTAGAGCTAAGTTTGGCCCTGGGGACCTATTACCCACCCATCCTCCTCCGACAACTGC

TCCCTACCCTTCTTCAGGGACCAAGTATCTTCACTGCCCCAAAGGAGGTTGCTGAGATCAA GGCCCAGCTGGAGACAACCCTGAAATCCAGGAACTATG

AGGTGAAACTCCGGCTGCTGCTGCACCTGGAAGAGCTGCAGATGGAGCATGACATCCGGCACTATGACCTGGACTCGGTACCCATGACCTGGGACCCTGT

GGACCAGAATCCCAGGCTGCTCACCCTGGAG GTTCCTGGTGTCGCAGAGAGCCGTCCCTCAGTGCTACGAGGTGACCACCTTTTTGCCCTTTTGTCCTC

TGAGACCCAACAGGACGACCCTGTCACCTACAAGGGTTTCGTGCACAAGGTGGAACTGGACCGTGTCAAGCTGAGCTTTTCTACAAG CCTCCTGAGCCG

ATTTGTGGATGGGCTGACCTTCAAGGTGAACTTTACCTTCAACCGCCAGCCCCTTCGGGTCCAGCACCGGGCCCTAGAGTTGACGGGGCGCTGGGTGCTA

TGGCCCATGCTTTTTCCTGTGGCCTCCCGTGGGGTCTCGTTGCTGCCCTCAGATGTGAAGTTCAA GCTGTACGATCGGAGTCTGGAGTCAAACCCTGAG

CAACTGCAGGCCATGAAGCACATTGTGAGGGGTACCACCCGGCCTGCCCCCTACATCATCTTTGGGCCTCCAGGTACCGGCAAGACTGTCACATTAGTGG

AGGCCATCAAACAG GTAGTGAAGCATTTGCCCAAAGCCCACATCCTGGCCTGTGCTCCATCCAACTCAGGGGCTGACCTCCTCTGTCAGCGGCTCCGGG

TCCACCTGCCCAGCTCCATCTACCGTCTCCTGGCCCCCAGCAGGGACATCCGAATGGTGCCTGAGGACATTAAG ACCTGCTGTAACTGGGATGCTAAGA

AGGGAGAATATGTGTATCCTGCTAAGAAGCACCTGCAGCAATATCGGGTCTTAATTACCACCCTCATCACTGCCAGCAG GTTGGTGTCAGCCCAGTTTC

CCATCGATCACTTCACACACATCTTCATCGATGAGGCTGGCCACTGCATGGAGCCTGAGAGTCTGGTGGCCATAGCAG GACTGATGGATGTCAAGGAAA

CGGGCAATCCCGGAGGGCAGCTGGTACTGGCAGGAGACCCTCGGCAGCTGGGGCCTGTGCTGCGCTCGCCACTAGCCCTGAAGCATGGACTTGGCTACTC

TCTGCTAGAGCGCCTGCTCGCCTACAACTCCTTGTATAAGAAGGGCCCCAATGGCTATGACCCCCAGTTCATCACCAAACTGCTCCGCAACTACAG GTC

TCACCCCACCATCCTGGACATCCCTAACCAGCTGTACTACGACGGAGAGCTGCAGGCCTGCGCAGATGTGGTGGATCGAGAACGGTTCTGCCGCTGGGAG

GGGCTGCCTCAGCAG GGCTTCCCCATCATTTTCCATGGTGTAATGGGCAAAGATGAGAGAGAAGGCAATAGCCCATCCTTCTTCAACCCTGAAGAGGCT

GCTACAGTGACGTCATACCTGAAACAACTCCTGGCCCCTTCCTCCAAGAAGGGTAAAGCCCGCCTGAGCCCCCGAAATGTGGGCGTCATCTCCCCGTACC

GGAAGCAG GTAGAAAAAATCCGTTACTGCATCACAAAACTTGACCGAGAACTTCGCGGACTGGATGACATCAAAGATTTGAAG - UNI9110 - GTG

GGCTCTGTGGAAGAGTTCCAAGGCCAAGAACGCAGCGTCATCCTCATCTCCACCGTCCGAAGCAGCCAGAGCTTTGTACAGCTGGATCTAGACTTTAACC

TCGGTTTCCTTAAGAACCCCAAG AGGTTCAATGTTGCTGTGACCCGAGCCAAGGCTTTGCTCATCGTAGTGGGCAACCCCCTCCTCCTAGGCCACGACC

CAGACTGGAAAAC - UNI13215 - GTTCCTGGAGTTCTGTAAAGAAAACGGGGGATATACCGGGTGCCCCTTTCCTGCCAAACTGGACCTGCAGCAG

GGACAGGACTTGCTCCAAGGTCTGAGCAAACTCAGCCCCTCTACCTCAG GGCCCCGCCGTCACCAGAATCTCCCCCAGGAGCGGGAGGGTGAAGGGGGC

CTGCCCTTACAAGTGGAGCCAGAGTGGAGAAATGAGCTCTGAGGCCACAGCCGCCCGCCTTCTCACACCAGCCAAGCCTTATTGCTGCCTATCCCTGACC

CAGAACCCAGCTCTCCTGTCCCTGCAAGAGATGGGAAGGCCGGGAAGTTTACAGCCCAGACCATTCCGCCCCTTCCTCTGCTAGGGAAGACAACCCAAGC

TGCTAAAACTCGGAGGAAGGGGGAGGAAGAAAGCTTTTTTTTTTTTTTAAACCCTCTCCTTTGCAGTGCTGGGGATCGAACCCAGAGCCTCAAATATGCT

AGGCAAGCACTCTGCCCCTGAGCTGCTTTAAGAAAAACAAAATGCTGTTCTATGC
Translation
 MPSKFSCRKLRETGQRFESFLAERGLDLETDRERLRTIYNHDFKPS - UNI13516 - SYGTPAPGFSSMLYGMKIANLAFVTKTRVRFFKLDRWAD

VQLPEKRRIKPGSNISKQHRSLLARIFHDR - UNI22663 - RAEYLHGKHGVDVEVQGPHEARDGQLLIHLDLNRKEVLTLRLRNGGSKPVTLTHLF

PLCWTPQFVFYHGEQDLPCPLGPGEC CYELHIYCKTSIVGYFPATVLWELLGPGESGAEGAETFYIARFLAAVAHSPLAAQLKPTTPFKRPPRLTRNSV

LTNRIEEGERPDR RAKGYELELSLALGTYYPPILLRQLLPTLLQGPSIFTAPKEVAEIK KAQLETTLKSRNYEVKLRLLLHLEELQMEHDIRHYDLDS

VPMTWDPVDQNPRLLTLE VPGVAESRPSVLRGDHLFALLSSETQQDDPVTYKGFVHKVELDRVKLSFSTS SLLSRFVDGLTFKVNFTFNRQPLRVQHR

ALELTGRWVLWPMLFPVASRGVSLLPSDVKFK KLYDRSLESNPEQLQAMKHIVRGTTRPAPYIIFGPPGTGKTVTLVEAIKQ VVKHLPKAHILACAPS

NSGADLLCQRLRVHLPSSIYRLLAPSRDIRMVPEDIK TCCNWDAKKGEYVYPAKKHLQQYRVLITTLITASR RLVSAQFPIDHFTHIFIDEAGHCMEP

ESLVAIAG GLMDVKETGNPGGQLVLAGDPRQLGPVLRSPLALKHGLGYSLLERLLAYNSLYKKGPNGYDPQFITKLLRNYR RSHPTILDIPNQLYYDG

ELQACADVVDRERFCRWEGLPQQ GFPIIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKQLLAPSSKKGKARLSPRNVGVISPYRKQ VEKIRYCITKL

DRELRGLDDIKDLK - UNI9110 - VGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLKNPK RFNVAVTRAKALLIVVGNPLLLGHDPDWKT

 - UNI13215 - TFLEFCKENGGYTGCPFPAKLDLQQGQDLLQGLSKLSPSTSG GPRRHQNLPQEREGEGGLPLQVEPEWRNEL
Transcript ENSMUST00000002297
Sequence
AGGAGGGGAGGCAGTCGGGGAGAAGGTGGCTGGCCGGAGCAGACGTCAGAGGTAGGGGGCTTTTCCCCTTTGCACCCTCACCCCAGACCAGCCAACTCTA

AACCGCGGCGGCGACTTTCAGTTTCATTTCCGCGGACCCTCCTGCCTGGGCCGCAGCCGCCGCCGCCGCGATGCCTAGCAAGTTCAGCTGCCGAAAGCTC

CGGGAGACCGGCCAGAGGTTCGAGAGTTTTCTGGCCGAACGTGGACTGGACCTGGAGACAGATCGTGAGCGGCTGCGGACGATTTACAACCACGACTTCA

AGCCCAG - UNI13516 - CTATGGGACCCCTGCCCCTGGCTTCTCCTCCATGCTGTATGGAATGAAGATCGCAAATCTGGCCTTCGTCACCAAGACT

CGGGTCAGGTTCTTCAAACTAGACCGCTGGGCTGATGTGCAGTTACCAGAAAAGAGGCGAATAAAGCCAGGGTCGAACATCAGCAAACAACACAGATCAC

TGTTGGCCAGGATCTTTCACGACAG - UNI22663 - GGCTGAGTACCTTCATGGGAAGCATGGGGTAGACGTGGAGGTCCAGGGGCCCCATGAAGCC

CGAGACGGGCAACTCCTTATCCACCTGGATTTGAACCGCAAGGAGGTACTAACCCTACGGCTTCGGAACGGCGGAAGCAAACCTGTCACCCTCACTCACC

TATTCCCACTGTGCTGGACGCCCCAGTTTGTCTTCTACCATGGAGAACAGGACCTGCCCTGCCCACTGGGCCCCGGTGAGTG CTATGAACTCCACATCT

ACTGTAAGACCAGCATTGTGGGTTACTTCCCAGCCACTGTCCTCTGGGAACTCCTGGGACCCGGGGAGTCGGGAGCAGAAGGAGCAGAAACTTTCTACAT

TGCCCGATTCCTGGCGGCTGTCGCCCACAGTCCCCTGGCTGCCCAGTTGAAACCCACAACTCCCTTCAAACGCCCCCCTCGGCTCACCAGAAACTCTGTG

TTGACCAACCGGATCGAGGAAGGAGAGAGGCCCGACCG AGCCAAGGGCTATGAACTAGAGCTAAGTTTGGCCCTGGGGACCTATTACCCACCCATCCTC

CTCCGACAACTGCTCCCTACCCTTCTTCAGGGACCAAGTATCTTCACTGCCCCAAAGGAGGTTGCTGAGATCAA GGCCCAGCTGGAGACAACCCTGAAA

TCCAGGAACTATGAGGTGAAACTCCGGCTGCTGCTGCACCTGGAAGAGCTGCAGATGGAGCATGACATCCGGCACTATGACCTGGACTCGGTACCCATGA

CCTGGGACCCTGTGGACCAGAATCCCAGGCTGCTCACCCTGGAG GTTCCTGGTGTCGCAGAGAGCCGTCCCTCAGTGCTACGAGGTGACCACCTTTTTG

CCCTTTTGTCCTCTGAGACCCAACAGGACGACCCTGTCACCTACAAGGGTTTCGTGCACAAGGTGGAACTGGACCGTGTCAAGCTGAGCTTTTCTACAAG

 CCTCCTGAGCCGATTTGTGGATGGGCTGACCTTCAAGGTGAACTTTACCTTCAACCGCCAGCCCCTTCGGGTCCAGCACCGGGCCCTAGAGTTGACGGG

GCGCTGGGTGCTATGGCCCATGCTTTTTCCTGTGGCCTCCCGTGGGGTCTCGTTGCTGCCCTCAGATGTGAAGTTCAA GCTGTACGATCGGAGTCTGGA

GTCAAACCCTGAGCAACTGCAGGCCATGAAGCACATTGTGAGGGGTACCACCCGGCCTGCCCCCTACATCATCTTTGGGCCTCCAGGTACCGGCAAGACT

GTCACATTAGTGGAGGCCATCAAACAG GTAGTGAAGCATTTGCCCAAAGCCCACATCCTGGCCTGTGCTCCATCCAACTCAGGGGCTGACCTCCTCTGT

CAGCGGCTCCGGGTCCACCTGCCCAGCTCCATCTACCGTCTCCTGGCCCCCAGCAGGGACATCCGAATGGTGCCTGAGGACATTAAG ACCTGCTGTAAC

TGGGATGCTAAGAAGGGAGAATATGTGTATCCTGCTAAGAAGCACCTGCAGCAATATCGGGTCTTAATTACCACCCTCATCACTGCCAGCAG GTTGGTG

TCAGCCCAGTTTCCCATCGATCACTTCACACACATCTTCATCGATGAGGCTGGCCACTGCATGGAGCCTGAGAGTCTGGTGGCCATAGCAG GACTGATG

GATGTCAAGGAAACGGGCAATCCCGGAGGGCAGCTGGTACTGGCAGGAGACCCTCGGCAGCTGGGGCCTGTGCTGCGCTCGCCACTAGCCCTGAAGCATG

GACTTGGCTACTCTCTGCTAGAGCGCCTGCTCGCCTACAACTCCTTGTATAAGAAGGGCCCCAATGGCTATGACCCCCAGTTCATCACCAAACTGCTCCG

CAACTACAG GTCTCACCCCACCATCCTGGACATCCCTAACCAGCTGTACTACGACGGAGAGCTGCAGGCCTGCGCAGATGTGGTGGATCGAGAACGGTT

CTGCCGCTGGGAGGGGCTGCCTCAGCAG GGCTTCCCCATCATTTTCCATGGTGTAATGGGCAAAGATGAGAGAGAAGGCAATAGCCCATCCTTCTTCAA

CCCTGAAGAGGCTGCTACAGTGACGTCATACCTGAAACAACTCCTGGCCCCTTCCTCCAAGAAGGGTAAAGCCCGCCTGAGCCCCCGAAATGTGGGCGTC

ATCTCCCCGTACCGGAAGCAG GTAGAAAAAATCCGTTACTGCATCACAAAACTTGACCGAGAACTTCGCGGACTGGATGACATCAAAGATTTGAAG - 

UNI9110 - GTGGGCTCTGTGGAAGAGTTCCAAGGCCAAGAACGCAGCGTCATCCTCATCTCCACCGTCCGAAGCAGCCAGAGCTTTGTACAGCTGGAT

CTAGACTTTAACCTCGGTTTCCTTAAGAACCCCAAG AGGTTCAATGTTGCTGTGACCCGAGCCAAGGCTTTGCTCATCGTAGTGGGCAACCCCCTCCTC

CTAGGCCACGACCCAGACTGGAAAAC - UNI13215 - GTTCCTGGAGTTCTGTAAAGAAAACGGGGGATATACCGGGTGCCCCTTTCCTGCCAAACT

GGACCTGCAGCAGGGACAGGACTTGCTCCAAGGTCTGAGCAAACTCAGCCCCTCTACCTCAG GGCCCCGCCGTCACCAGAATCTCCCCCAGGAGCGGGA

GGGTGAAGGGGGCCTGCCCTTACAAGTGGAGCCAGAGTGGAGAAATGAGCTCTGAGGCCACAGCCGCCCGCCTTCTCACACCAGCCAAGCCTTATTGCTG

CCTATCCCTGACCCAGAACCCAGCTCTCCTGTCCCTGCAAGAGATGGGAAGGCCGGGAAGTTTACAGCCCAGACCATTCCGCCCCTTCCTCTGCTAGGGA

AGACAACCCAAGCTGCTAAAACTCGGAGGAAGGGGGAGGAAGAAAGCTTTTTTTTTTTTTTAAACCCTCTCCTTTGCAGTGCTGGGGATCGAACCCAGAG

CCTCAAATATGCTAGGCAAGCACTCTGCCCCTGAGCTGCTTTAAGAAAAACAAAATGCTGTTCTATGC
Translation
MPSKFSCRKLRETGQRFESFLAERGLDLETDRERLRTIYNHDFKPS - UNI13516 - SYGTPAPGFSSMLYGMKIANLAFVTKTRVRFFKLDRWADV

QLPEKRRIKPGSNISKQHRSLLARIFHDR - UNI22663 - RAEYLHGKHGVDVEVQGPHEARDGQLLIHLDLNRKEVLTLRLRNGGSKPVTLTHLFP

LCWTPQFVFYHGEQDLPCPLGPGEC CYELHIYCKTSIVGYFPATVLWELLGPGESGAEGAETFYIARFLAAVAHSPLAAQLKPTTPFKRPPRLTRNSVL

TNRIEEGERPDR RAKGYELELSLALGTYYPPILLRQLLPTLLQGPSIFTAPKEVAEIK KAQLETTLKSRNYEVKLRLLLHLEELQMEHDIRHYDLDSV

PMTWDPVDQNPRLLTLE VPGVAESRPSVLRGDHLFALLSSETQQDDPVTYKGFVHKVELDRVKLSFSTS SLLSRFVDGLTFKVNFTFNRQPLRVQHRA

LELTGRWVLWPMLFPVASRGVSLLPSDVKFK KLYDRSLESNPEQLQAMKHIVRGTTRPAPYIIFGPPGTGKTVTLVEAIKQ VVKHLPKAHILACAPSN

SGADLLCQRLRVHLPSSIYRLLAPSRDIRMVPEDIK TCCNWDAKKGEYVYPAKKHLQQYRVLITTLITASR RLVSAQFPIDHFTHIFIDEAGHCMEPE

SLVAIAG GLMDVKETGNPGGQLVLAGDPRQLGPVLRSPLALKHGLGYSLLERLLAYNSLYKKGPNGYDPQFITKLLRNYR RSHPTILDIPNQLYYDGE

LQACADVVDRERFCRWEGLPQQ GFPIIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKQLLAPSSKKGKARLSPRNVGVISPYRKQ VEKIRYCITKLD

RELRGLDDIKDLK - UNI9110 - VGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLKNPK RFNVAVTRAKALLIVVGNPLLLGHDPDWKT 

- UNI13215 - TFLEFCKENGGYTGCPFPAKLDLQQGQDLLQGLSKLSPSTSG GPRRHQNLPQEREGEGGLPLQVEPEWRNEL
Transcript ENSMUST00000106774
Sequence
GCTGGACGAGCGGCCCCAGTCCAGCTGCAGCCGACCCATGTCCGGGGCTCTGCCCTTTGCTCTGCAGCTTTTCTATGTCCCGAGGCTCTGGAGAGTGGGC

GTGGGAGTAGCCCTAGCTGAGGCTCCAAGGTCCTCCGGGCTGTTTAGGGGGCCCCAGGCGATATCCACGTTCGGATCCTGGCTCGCTGCCAGGGGAGGGA

GCTCGGGGTAAGGGGAGGGCCCTGAGGGAGGGGTCAGACTCCTTAGGAAAGAGTTAATGTGAAGGGGGGGAGGGGATAGGACGAAGAGACCGAAAGGAAG

GCTCAG ACCAGCCAACTCTAAACCGCGGCGGCGACTTTCAGTTTCATTTCCGCGGACCCTCCTGCCTGGGCCGCAGCCGCCGCCGCCGCGATGCCTAGC

AAGTTCAGCTGCCGAAAGCTCCGGGAGACCGGCCAGAGGTTCGAGAGTTTTCTGGCCGAACGTGGACTGGACCTGGAGACAGATCGTGAGCGGCTGCGGA

CGATTTACAACCACGACTTCAAGCCCAG - UNI13516 - CTATGGGACCCCTGCCCCTGGCTTCTCCTCCATGCTGTATGGAATGAAGATCGCAAAT

CTGGCCTTCGTCACCAAGACTCGGGTCAGGTTCTTCAAACTAGACCGCTGGGCTGATGTGCAGTTACCAGAAAAGAGGCGAATAAAGCCAGGGTCGAACA

TCAGCAAACAACACAGATCACTGTTGGCCAGGATCTTTCACGACAG - UNI22663 - GGCTGAGTACCTTCATGGGAAGCATGGGGTAGACGTGGAG

GTCCAGGGGCCCCATGAAGCCCGAGACGGGCAACTCCTTATCCACCTGGATTTGAACCGCAAGGAGGTACTAACCCTACGGCTTCGGAACGGCGGAAGCA

AACCTGTCACCCTCACTCACCTATTCCCACTGTGCTGGACGCCCCAGTTTGTCTTCTACCATGGAGAACAGGACCTGCCCTGCCCACTGGGCCCCGGTGA

GTG CTATGAACTCCACATCTACTGTAAGACCAGCATTGTGGGTTACTTCCCAGCCACTGTCCTCTGGGAACTCCTGGGACCCGGGGAGTCGGGAGCAGA

AGGAGCAGAAACTTTCTACATTGCCCGATTCCTGGCGGCTGTCGCCCACAGTCCCCTGGCTGCCCAGTTGAAACCCACAACTCCCTTCAAACGCCCCCCT

CGGCTCACCAGAAACTCTGTGTTGACCAACCGGATCGAGGAAGGAGAGAGGCCCGACCG AGCCAAGGGCTATGAACTAGAGCTAAGTTTGGCCCTGGGG

ACCTATTACCCACCCATCCTCCTCCGACAACTGCTCCCTACCCTTCTTCAGGGACCAAGTATCTTCACTGCCCCAAAGGAGGTTGCTGAGATCAA GGCC

CAGCTGGAGACAACCCTGAAATCCAGGAACTATGAGGTGAAACTCCGGCTGCTGCTGCACCTGGAAGAGCTGCAGATGGAGCATGACATCCGGCACTATG

ACCTGGACTCGGTACCCATGACCTGGGACCCTGTGGACCAGAATCCCAGGCTGCTCACCCTGGAG GTTCCTGGTGTCGCAGAGAGCCGTCCCTCAGTGC

TACGAGGTGACCACCTTTTTGCCCTTTTGTCCTCTGAGACCCAACAGGACGACCCTGTCACCTACAAGGGTTTCGTGCACAAGGTGGAACTGGACCGTGT

CAAGCTGAGCTTTTCTACAAG CCTCCTGAGCCGATTTGTGGATGGGCTGACCTTCAAGGTGAACTTTACCTTCAACCGCCAGCCCCTTCGGGTCCAGCA

CCGGGCCCTAGAGTTGACGGGGCGCTGGGTGCTATGGCCCATGCTTTTTCCTGTGGCCTCCCGTGGGGTCTCGTTGCTGCCCTCAGATGTGAAGTTCAA 

GCTGTACGATCGGAGTCTGGAGTCAAACCCTGAGCAACTGCAGGCCATGAAGCACATTGTGAGGGGTACCACCCGGCCTGCCCCCTACATCATCTTTGGG

CCTCCAGGTACCGGCAAGACTGTCACATTAGTGGAGGCCATCAAACAG GTAGTGAAGCATTTGCCCAAAGCCCACATCCTGGCCTGTGCTCCATCCAAC

TCAGGGGCTGACCTCCTCTGTCAGCGGCTCCGGGTCCACCTGCCCAGCTCCATCTACCGTCTCCTGGCCCCCAGCAGGGACATCCGAATGGTGCCTGAGG

ACATTAAG ACCTGCTGTAACTGGGATGCTAAGAAGGGAGAATATGTGTATCCTGCTAAGAAGCACCTGCAGCAATATCGGGTCTTAATTACCACCCTCA

TCACTGCCAGCAG GTTGGTGTCAGCCCAGTTTCCCATCGATCACTTCACACACATCTTCATCGATGAGGCTGGCCACTGCATGGAGCCTGAGAGTCTGG

TGGCCATAGCAG GACTGATGGATGTCAAGGAAACGGGCAATCCCGGAGGGCAGCTGGTACTGGCAGGAGACCCTCGGCAGCTGGGGCCTGTGCTGCGCT

CGCCACTAGCCCTGAAGCATGGACTTGGCTACTCTCTGCTAGAGCGCCTGCTCGCCTACAACTCCTTGTATAAGAAGGGCCCCAATGGCTATGACCCCCA

GTTCATCACCAAACTGCTCCGCAACTACAG GTCTCACCCCACCATCCTGGACATCCCTAACCAGCTGTACTACGACGGAGAGCTGCAGGCCTGCGCAGA

TGTGGTGGATCGAGAACGGTTCTGCCGCTGGGAGGGGCTGCCTCAGCAG GGCTTCCCCATCATTTTCCATGGTGTAATGGGCAAAGATGAGAGAGAAGG

CAATAGCCCATCCTTCTTCAACCCTGAAGAGGCTGCTACAGTGACGTCATACCTGAAACAACTCCTGGCCCCTTCCTCCAAGAAGGGTAAAGCCCGCCTG

AGCCCCCGAAATGTGGGCGTCATCTCCCCGTACCGGAAGCAG GTAGAAAAAATCCGTTACTGCATCACAAAACTTGACCGAGAACTTCGCGGACTGGAT

GACATCAAAGATTTGAAG - UNI9110 - GTGGGCTCTGTGGAAGAGTTCCAAGGCCAAGAACGCAGCGTCATCCTCATCTCCACCGTCCGAAGCAGC

CAGAGCTTTGTACAGCTGGATCTAGACTTTAACCTCGGTTTCCTTAAGAACCCCAAG AGGTTCAATGTTGCTGTGACCCGAGCCAAGGCTTTGCTCATC

GTAGTGGGCAACCCCCTCCTCCTAGGCCACGACCCAGACTGGAAAAC - UNI13215 - GTTCCTGGAGTTCTGTAAAGAAAACGGGGGATATACCGG

GTGCCCCTTTCCTGCCAAACTGGACCTGCAGCAGGGACAGGACTTGCTCCAAGGTCTGAGCAAACTCAGCCCCTCTACCTCAG GGCCCCGCCGTCACCA

GAATCTCCCCCAGGAGCGGGAGGGTGAAGGGGGCCTGCCCTTACAAGTGGAGCCAGAGTGGAGAAATGAGCTCTGAGGCCACAGCCGCCCGCCTTCTCAC

ACCAGCCAAGCCTTATTGCTGCCTATCCCTGACCCAGAACCCAGCTCTCCTGTCCCTGCAAGAGATGGGAAGGCCGGGAAGTTTACAGCCCAGACCATTC

CGCCCCTTCCTCTGCTAGGGAAGACAACCCAAGCTGCTAAAACTCGGAGGAAGGGGGAGGAAGAAAGCTTTTTTTTTTTTTTAAACCCTCTCCTTTGCAG

TGCTGGGGATCGAACCCAGAGCCTCAAATATGCTAGGCAAGCACTCTGCCCCTGAGCTGCTTTAAGAAAAACAAAATGCTGTTCTATGC
Translation
 MPSKFSCRKLRETGQRFESFLAERGLDLETDRERLRTIYNHDFKPS - UNI13516 - SYGTPAPGFSSMLYGMKIANLAFVTKTRVRFFKLDRWAD

VQLPEKRRIKPGSNISKQHRSLLARIFHDR - UNI22663 - RAEYLHGKHGVDVEVQGPHEARDGQLLIHLDLNRKEVLTLRLRNGGSKPVTLTHLF

PLCWTPQFVFYHGEQDLPCPLGPGEC CYELHIYCKTSIVGYFPATVLWELLGPGESGAEGAETFYIARFLAAVAHSPLAAQLKPTTPFKRPPRLTRNSV

LTNRIEEGERPDR RAKGYELELSLALGTYYPPILLRQLLPTLLQGPSIFTAPKEVAEIK KAQLETTLKSRNYEVKLRLLLHLEELQMEHDIRHYDLDS

VPMTWDPVDQNPRLLTLE VPGVAESRPSVLRGDHLFALLSSETQQDDPVTYKGFVHKVELDRVKLSFSTS SLLSRFVDGLTFKVNFTFNRQPLRVQHR

ALELTGRWVLWPMLFPVASRGVSLLPSDVKFK KLYDRSLESNPEQLQAMKHIVRGTTRPAPYIIFGPPGTGKTVTLVEAIKQ VVKHLPKAHILACAPS

NSGADLLCQRLRVHLPSSIYRLLAPSRDIRMVPEDIK TCCNWDAKKGEYVYPAKKHLQQYRVLITTLITASR RLVSAQFPIDHFTHIFIDEAGHCMEP

ESLVAIAG GLMDVKETGNPGGQLVLAGDPRQLGPVLRSPLALKHGLGYSLLERLLAYNSLYKKGPNGYDPQFITKLLRNYR RSHPTILDIPNQLYYDG

ELQACADVVDRERFCRWEGLPQQ GFPIIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKQLLAPSSKKGKARLSPRNVGVISPYRKQ VEKIRYCITKL

DRELRGLDDIKDLK - UNI9110 - VGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLKNPK RFNVAVTRAKALLIVVGNPLLLGHDPDWKT

 - UNI13215 - TFLEFCKENGGYTGCPFPAKLDLQQGQDLLQGLSKLSPSTSG GPRRHQNLPQEREGEGGLPLQVEPEWRNEL
Transcript ENSMUST00000106777
Sequence
AGGAGGGGAGGCAGTCGGGGAGAAGGTGGCTGGCCGGAGCAGACGTCAGAGGTAGGGGGCTTTTCCCCTTTGCACCCTCACCCCAGACCAGCCAACTCTA

AACCGCGGCGGCGACTTTCAGTTTCATTTCCGCGGACCCTCCTGCCTGGGCCGCAGCCGCCGCCGCCGCGATGCCTAGCAAGTTCAGCTGCCGAAAGCTC

CGGGAGACCGGCCAGAGGTTCGAGAGTTTTCTGGCCGAACGTGGACTGGACCTGGAGACAGATCGTGAGCGGCTGCGGACGATTTACAACCACGACTTCA

AGCCCAG - UNI13516 - CTATGGGACCCCTGCCCCTGGCTTCTCCTCCATGCTGTATGGAATGAAGATCGCAAATCTGGCCTTCGTCACCAAGACT

CGGGTCAGGTTCTTCAAACTAGACCGCTGGGCTGATGTGCAGTTACCAGAAAAGAGGCGAATAAAGCCAGGGTCGAACATCAGCAAACAACACAGATCAC

TGTTGGCCAGGATCTTTCACGACAG - UNI22663 - GGCTGAGTACCTTCATGGGAAGCATGGGGTAGACGTGGAGGTCCAGGGGCCCCATGAAGCC

CGAGACGGGCAACTCCTTATCCACCTGGATTTGAACCGCAAGGAGGTACTAACCCTACGGCTTCGGAACGGCGGAAGCAAACCTGTCACCCTCACTCACC

TATTCCCACTGTGCTGGACGCCCCAGTTTGTCTTCTACCATGGAGAACAGGACCTGCCCTGCCCACTGGGCCCCG - UNI22663 - GTGAAAGCTAT

GAACTCCACATCTACTGTAAGACCAGCATTGTGGGTTACTTCCCAGCCACTGTCCTCTGGGAACTCCTGGGACCCGGGGAGTCGGGAGCAGAAGGAGCAG

AAACTTTCTACATTGCCCGATTCCTGGCGGCTGTCGCCCACAGTCCCCTGGCTGCCCAGTTGAAACCCACAACTCCCTTCAAACGCCCCCCTCGGCTCAC

CAGAAACTCTGTGTTGACCAACCGGATCGAGGAAGGAGAGAGGCCCGACCG AGCCAAGGGCTATGAACTAGAGCTAAGTTTGGCCCTGGGGACCTATTA

CCCACCCATCCTCCTCCGACAACTGCTCCCTACCCTTCTTCAGGGACCAAGTATCTTCACTGCCCCAAAGGAGGTTGCTGAGATCAA GGCCCAGCTGGA

GACAACCCTGAAATCCAGGAACTATGAGGTGAAACTCCGGCTGCTGCTGCACCTGGAAGAGCTGCAGATGGAGCATGACATCCGGCACTATGACCTGGAC

TCGGTACCCATGACCTGGGACCCTGTGGACCAGAATCCCAGGCTGCTCACCCTGGAG GTTCCTGGTGTCGCAGAGAGCCGTCCCTCAGTGCTACGAGGT

GACCACCTTTTTGCCCTTTTGTCCTCTGAGACCCAACAGGACGACCCTGTCACCTACAAGGGTTTCGTGCACAAGGTGGAACTGGACCGTGTCAAGCTGA

GCTTTTCTACAAG CCTCCTGAGCCGATTTGTGGATGGGCTGACCTTCAAGGTGAACTTTACCTTCAACCGCCAGCCCCTTCGGGTCCAGCACCGGGCCC

TAGAGTTGACGGGGCGCTGGGTGCTATGGCCCATGCTTTTTCCTGTGGCCTCCCGTGGGGTCTCGTTGCTGCCCTCAGATGTGAAGTTCAA GCTGTACG

ATCGGAGTCTGGAGTCAAACCCTGAGCAACTGCAGGCCATGAAGCACATTGTGAGGGGTACCACCCGGCCTGCCCCCTACATCATCTTTGGGCCTCCAGG

TACCGGCAAGACTGTCACATTAGTGGAGGCCATCAAACAG GTAGTGAAGCATTTGCCCAAAGCCCACATCCTGGCCTGTGCTCCATCCAACTCAGGGGC

TGACCTCCTCTGTCAGCGGCTCCGGGTCCACCTGCCCAGCTCCATCTACCGTCTCCTGGCCCCCAGCAGGGACATCCGAATGGTGCCTGAGGACATTAAG

 ACCTGCTGTAACTGGGATGCTAAGAAGGGAGAATATGTGTATCCTGCTAAGAAGCACCTGCAGCAATATCGGGTCTTAATTACCACCCTCATCACTGCC

AGCAG GTTGGTGTCAGCCCAGTTTCCCATCGATCACTTCACACACATCTTCATCGATGAGGCTGGCCACTGCATGGAGCCTGAGAGTCTGGTGGCCATA

GCAG GACTGATGGATGTCAAGGAAACGGGCAATCCCGGAGGGCAGCTGGTACTGGCAGGAGACCCTCGGCAGCTGGGGCCTGTGCTGCGCTCGCCACTA

GCCCTGAAGCATGGACTTGGCTACTCTCTGCTAGAGCGCCTGCTCGCCTACAACTCCTTGTATAAGAAGGGCCCCAATGGCTATGACCCCCAGTTCATCA

CCAAACTGCTCCGCAACTACAG GTCTCACCCCACCATCCTGGACATCCCTAACCAGCTGTACTACGACGGAGAGCTGCAGGCCTGCGCAGATGTGGTGG

ATCGAGAACGGTTCTGCCGCTGGGAGGGGCTGCCTCAGCAG GGCTTCCCCATCATTTTCCATGGTGTAATGGGCAAAGATGAGAGAGAAGGCAATAGCC

CATCCTTCTTCAACCCTGAAGAGGCTGCTACAGTGACGTCATACCTGAAACAACTCCTGGCCCCTTCCTCCAAGAAGGGTAAAGCCCGCCTGAGCCCCCG

AAATGTGGGCGTCATCTCCCCGTACCGGAAGCAG GTAGAAAAAATCCGTTACTGCATCACAAAACTTGACCGAGAACTTCGCGGACTGGATGACATCAA

AGATTTGAAG - UNI9110 - GTGGGCTCTGTGGAAGAGTTCCAAGGCCAAGAACGCAGCGTCATCCTCATCTCCACCGTCCGAAGCAGCCAGAGCTT

TGTACAGCTGGATCTAGACTTTAACCTCGGTTTCCTTAAGAACCCCAAG AGGTTCAATGTTGCTGTGACCCGAGCCAAGGCTTTGCTCATCGTAGTGGG

CAACCCCCTCCTCCTAGGCCACGACCCAGACTGGAAAAC - UNI13215 - GTTCCTGGAGTTCTGTAAAGAAAACGGGGGATATACCGGGTGCCCCT

TTCCTGCCAAACTGGACCTGCAGCAGGGACAGGACTTGCTCCAAGGTCTGAGCAAACTCAGCCCCTCTACCTCAG GGCCCCGCCGTCACCAGAATCTCC

CCCAGGAGCGGGAGGGTGAAGGGGGCCTGCCCTTACAAGTGGAGCCAGAGTGGAGAAATGAGCTCTGAGGCCACAGCCGCCCGCCTTCTCACACCAGCCA

AGCCTTATTGCTGCCTATCCCTGACCCAGAACCCAGCTCTCCTGTCCCTGCAAGAGATGGGAAGGCCGGGAAGTTTACAGCCCAGACCATTCCGCCCCTT

CCTCTGCTAGGGAAGACAACCCAAGCTGCTAAAACTCGGAGGAAGGGGGAGGAAGAAAGCTTTTTTTTTTTTTTAAACCCTCTCCTTTGCAGTGCTGGGG

ATCGAACCCAGAGCCTCAAATATGCTAGGCAAGCACTCTGCCCCTGAGCTGCTTTAAGAAAAACAAAATGCTGTTCTATGC
Translation
MPSKFSCRKLRETGQRFESFLAERGLDLETDRERLRTIYNHDFKPS - UNI13516 - SYGTPAPGFSSMLYGMKIANLAFVTKTRVRFFKLDRWADV

QLPEKRRIKPGSNISKQHRSLLARIFHDR - UNI22663 - RAEYLHGKHGVDVEVQGPHEARDGQLLIHLDLNRKEVLTLRLRNGGSKPVTLTHLFP

LCWTPQFVFYHGEQDLPCPLGPG - UNI22663 - GESYELHIYCKTSIVGYFPATVLWELLGPGESGAEGAETFYIARFLAAVAHSPLAAQLKPTTP

FKRPPRLTRNSVLTNRIEEGERPDR RAKGYELELSLALGTYYPPILLRQLLPTLLQGPSIFTAPKEVAEIK KAQLETTLKSRNYEVKLRLLLHLEELQ

MEHDIRHYDLDSVPMTWDPVDQNPRLLTLE VPGVAESRPSVLRGDHLFALLSSETQQDDPVTYKGFVHKVELDRVKLSFSTS SLLSRFVDGLTFKVNF

TFNRQPLRVQHRALELTGRWVLWPMLFPVASRGVSLLPSDVKFK KLYDRSLESNPEQLQAMKHIVRGTTRPAPYIIFGPPGTGKTVTLVEAIKQ VVKH

LPKAHILACAPSNSGADLLCQRLRVHLPSSIYRLLAPSRDIRMVPEDIK TCCNWDAKKGEYVYPAKKHLQQYRVLITTLITASR RLVSAQFPIDHFTH

IFIDEAGHCMEPESLVAIAG GLMDVKETGNPGGQLVLAGDPRQLGPVLRSPLALKHGLGYSLLERLLAYNSLYKKGPNGYDPQFITKLLRNYR RSHPT

ILDIPNQLYYDGELQACADVVDRERFCRWEGLPQQ GFPIIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKQLLAPSSKKGKARLSPRNVGVISPYRKQ

 VEKIRYCITKLDRELRGLDDIKDLK - UNI9110 - VGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLKNPK RFNVAVTRAKALLIVVGN

PLLLGHDPDWKT - UNI13215 - TFLEFCKENGGYTGCPFPAKLDLQQGQDLLQGLSKLSPSTSG GPRRHQNLPQEREGEGGLPLQVEPEWRNEL

For any suggestions or comments, please send an email to unitrap@crg.es