Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002249 (Tead3)
Chromosomal location
Chr 17: 28468620 - 28487545 (-)
Description
TEA domain family member 3 Gene [Source:MGI Symbol;Acc:MGI:109241]
RefSeq_peptide
NP_035696.3 NP_001091696.2 
UniGene
Mm.6655 Mm.450795 
MGI
MGI:109241 
Uniprot/SWISSPROT
P70210 
Uniprot/SPTREMBL
Q80V67 Q8R2N6 Q8VCA7 Q9Z0P8 
Human Ortholog
ENSG00000007866 (TEAD3)
Omim not available
UniTrap UNI14326
Vector Insertion
Chr 17: 28478293 - 28487546
Public Clones FHCRC-GT-S19-4E1 (fhcrc) IST15051F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20972
Vector Insertion
Chr 17: 28478293 - 28478546
Public Clones not available
Private Clones OST346970 (lexicon) OST175817 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22133
Vector Insertion
Chr 17: 28471982 - 28472429
Public Clones not available
Private Clones OST307395 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000080572
Sequence
GGGGAATGCAACTCGGAGGCCTCGCGCGCAGAG - UNI14326 - - UNI20972 - GCTCAGGCCATCCAGGGGGCTCAGGCCCAGAGCCCAAAGC

AACCAGCACAATAGCGTCCAACAGCTGGACCGCCAACAGCAGCCCCGGGGAGGCCCGGGAAGATGGGTCCGAAGGCCTGGACAAGGGTCTGGACAACGAT

GCGGAGGGAGTGTGGAGCCCGGACATCGAGCAGAGCTTTCAGGAGGCCCTGGCCATCTACCCGCCTTGCGGACGGCGCAAGATCATCCTGTCAGATGAGG

GCAAGATGTACG - UNI14326 - - UNI20972 - GTCGAAATGAGCTGATTGCCCGCTACATCAAGCTGAGGACTGGAAAAACCAGGACAAGAAA

ACAG GTGTCCAGCCACATACAGGTTCTAGCTCGGAAGAAGGTTCGGGAATACCAGGTTGGCATTAAG GCTATGAACCTG - UNI22133 - GACCA

AGTCTCCAAGGACAAAGCTCTCCAGAGCATGGCATCCATGTCGTCTGCCCAAATCGTCTCTGCCAGCGTTCTACAGAACAAGTTCAGCCCGCCCTCCCCT

CTACCCCAGGCTGTCTTCTCCTCCTCCTCAAGG TTCTGGAGCAGCCCCCCTCTGCTAGGACAACAGCCTGGACCTTCTCAGGA CATCAAGCCCTTTGC

CCAGCCTGCCTACCCCATCCAGCCTCCCTTGCCACCAGCGCTCAACA GTTATGAGTCCCTCGCCCCGCTGCCCCCAGCCGCTGCCTCAGCCACCGCCTC

TGCGCCTGCATGGCAGGACCGCACCATCGCCTCCTCCCGGCTACGCCTCCTGGAGTATTCTGCCTTCATGGAGGTGCAACGGGACCCTGACACG TACAG

CAAACACCTGTTTGTACACATCGGCCAGACAAACCCTGCCTTCTCAGACCCACCCCTGGAGGCAGTGGATGTACGACAGATCTACGACAAGTTCCCCGAG

AAGAAGGGGGGGCTGAAGGAACTCTACGAGAAGGGGCCCCCGAACGCTTTCTTCCTTGTCAAGTTCTGG GCTGACCTCAACAGCACAATCCAGGAAGGC

CCTGGGGCCTTCTACGGGGTCAGCTCGCAGTACAGCTCAGCCGACAGCATGACCATCAGCGTCTCCACCAAGGTCTGCTCCTTCGGCAAGCAGGTGGTAG

AGAAGGTGGAG ACCGAGTACGCCCGCCTGGAGAACGGCCGCTTCGTGTACCGCATCCACCGCTCACCCATGTGCGAGTACATGATCAATTTCATCCACA

AACTGAAGCATCTGCCCGAGAAGTACATGATGAACAGTGTGCTGGAGAACTTCACCATCCTGCAG GTGGTCACAAGTCGGGACTCGCAGGAGACCCTGC

TGGTCATTGCTTTTGTCTTTGAAGTCTCCACCAGCGAGCATGGGGCGCAGCACCACGTCTACAAGCTTGTCAAAGACTAGCCAGCCCTCGACCTCCACAG

GATGCAAGGCGGACATCCTCCACACACCTGCCTGCCTGGTCTTCCCGTGTGGGTTGGGGGACCTAGCCCAGCCCCCCTGGGTTTCAGGCTGGGACCCAGG

CTGCCTCCCTGGCTCCAGCACACATGCTCCCTGCCACTGTTCTGCGCTTTACTGGAGAGAAGAGGGCTCCACGGTGGGGTGGCTTGCTTGGGCACTGAGC

CACAGATGACCAGGCTCCACCTGGCCTCAAGTGACACCAGAATTGTACCATGGAGGACACCTTGGGGCTTAGTGTGTGGTTGCTGGCCCCTAGGGGAATG

AATGTGCTGGGCAGGTGAGGGTTGCATTGAGACTGGGGAAAGGCAGCTTGCAAGGAGGCCCTGGTACAAGGTGTCAGGTTGGGGAGGTTGAGAAGGGCCC

ACACTTCTTTGTACCTTCTGGGTACCAGTCTGTTCCCAGGTCCCTTACCCAGCAAGTTTGGGTCTCCCATATCAGACAATGTGCCAAGATGGAGGCCCAC

AGAAGTGGACGGAGGGAGCTGGGGCTGGTTCAGCTACCTCCCTAGCAGAGCTGCCTATGGGGCGGGGAAGGGGCTCTGCTGGGCTGAAGCCTAGACAGGG

CTCTATTTCCTGTTCCCCCCAGCATACCAGCCACTAGCGCCCCCCCCCCCCCCCGCCCTCTTCTGTGTCCTGAAGACAGGTGGCAGGGAACAGGAGGCTG

CCTCTGCCTTCTCCACATCCAGGTCCCAAGGTCACCTGGGTATTTATGAGTTTCAAATGAAGTACTGTGCCCCCAATCCAGCCCGAGCTTCCGGAAGGTT

TTCGCCATTGCTCAGGCCACCTCCAAACCCCACGTAGGTTTTATAACATGTATTATATATATATATTTTTGTGTATTTTTAAAATCCAGCTGTGATGGGC

TACATCATAAATGGCTCAAGGCAGGGGCCACTCAAGGCCTGGCTCCTGCTTTAAAGAAAAAAATTAAAAAGCTGTTTCTGGGTCAAGACAGTTGTGCCAT

ATGCAACCTTGTACCCTACCTAGTC
Translation
 - UNI14326 - - UNI20972 - IASNSWTANSSPGEAREDGSEGLDKGLDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYG - UN

I14326 - - UNI20972 - GRNELIARYIKLRTGKTRTRKQ VSSHIQVLARKKVREYQVGIK AMNL - UNI22133 - DQVSKDKALQSMASM

SSAQIVSASVLQNKFSPPSPLPQAVFSSSSR FWSSPPLLGQQPGPSQD DIKPFAQPAYPIQPPLPPALNS SYESLAPLPPAAASATASAPAWQDRTI

ASSRLRLLEYSAFMEVQRDPDT YSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFW ADLNSTIQEGPGAFYGVS

SQYSSADSMTISVSTKVCSFGKQVVEKVE TEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQ VVTSRDSQETLLVIAFVF

EVSTSEHGAQHHVYKLVKD
Transcript ENSMUST00000114799
Sequence
GGGGAATGCAACTCGGAGGCCTCGCGCGCAGAG - UNI14326 - - UNI20972 - GCTCAGGCCATCCAGGGGGCTCAGGCCCAGAGCCCAAAGC

AACCAGCACAATAGCGTCCAACAGCTGGACCGCCAACAGCAGCCCCGGGGAGGCCCGGGAAGATGGGTCCGAAGGCCTGGACAAGGGTCTGGACAACGAT

GCGGAGGGAGTGTGGAGCCCGGACATCGAGCAGAGCTTTCAGGAGGCCCTGGCCATCTACCCGCCTTGCGGACGGCGCAAGATCATCCTGTCAGATGAGG

GCAAGATGTACG - UNI14326 - - UNI20972 - GTCGAAATGAGCTGATTGCCCGCTACATCAAGCTGAGGACTGGAAAAACCAGGACAAGAAA

ACAG GTGTCCAGCCACATACAGGTTCTAGCTCGGAAGAAGGTTCGGGAATACCAGGTTGGCATTAAG GCTATGAACCTG - UNI22133 - GACCA

AGTCTCCAAGGACAAAGCTCTCCAGAGCATGGCATCCATGTCGTCTGCCCAAATCGTCTCTGCCAGCGTTCTACAGAACAAGTTCAGCCCGCCCTCCCCT

CTACCCCAGGCTGTCTTCTCCTCCTCCTCAAGG TTCTGGAGCAGCCCCCCTCTGCTAGGACAACAGCCTGGACCTTCTCAGGA CATCAAGCCCTTTGC

CCAGCCTGCCTACCCCATCCAGCCTCCCTTGCCACCAGCGCTCAACA GTTATGAGTCCCTCGCCCCGCTGCCCCCAGCCGCTGCCTCAGCCACCGCCTC

TGCGCCTGCATGGCAGGACCGCACCATCGCCTCCTCCCGGCTACGCCTCCTGGAGTATTCTGCCTTCATGGAGGTGCAACGGGACCCTGACACG TACAG

CAAACACCTGTTTGTACACATCGGCCAGACAAACCCTGCCTTCTCAGACCCACCCCTGGAGGCAGTGGATGTACGACAGATCTACGACAAGTTCCCCGAG

AAGAAGGGGGGGCTGAAGGAACTCTACGAGAAGGGGCCCCCGAACGCTTTCTTCCTTGTCAAGTTCTGG GCTGACCTCAACAGCACAATCCAGGAAGGC

CCTGGGGCCTTCTACGGGGTCAGCTCGCAGTACAGCTCAGCCGACAGCATGACCATCAGCGTCTCCACCAAGGTCTGCTCCTTCGGCAAGCAGGTGGTAG

AGAAGGTGGAG ACCGAGTACGCCCGCCTGGAGAACGGCCGCTTCGTGTACCGCATCCACCGCTCACCCATGTGCGAGTACATGATCAATTTCATCCACA

AACTGAAGCATCTGCCCGAGAAGTACATGATGAACAGTGTGCTGGAGAACTTCACCATCCTGCAG GTGGTCACAAGTCGGGACTCGCAGGAGACCCTGC

TGGTCATTGCTTTTGTCTTTGAAGTCTCCACCAGCGAGCATGGGGCGCAGCACCACGTCTACAAGCTTGTCAAAGACTAGCCAGCCCTCGACCTCCACAG

GATGCAAGGCGGACATCCTCCACACACCTGCCTGCCTGGTCTTCCCGTGTGGGTTGGGGGACCTAGCCCAGCCCCCCTGGGTTTCAGGCTGGGACCCAGG

CTGCCTCCCTGGCTCCAGCACACATGCTCCCTGCCACTGTTCTGCGCTTTACTGGAGAGAAGAGGGCTCCACGGTGGGGTGGCTTGCTTGGGCACTGAGC

CACAGATGACCAGGCTCCACCTGGCCTCAAGTGACACCAGAATTGTACCATGGAGGACACCTTGGGGCTTAGTGTGTGGTTGCTGGCCCCTAGGGGAATG

AATGTGCTGGGCAGGTGAGGGTTGCATTGAGACTGGGGAAAGGCAGCTTGCAAGGAGGCCCTGGTACAAGGTGTCAGGTTGGGGAGGTTGAGAAGGGCCC

ACACTTCTTTGTACCTTCTGGGTACCAGTCTGTTCCCAGGTCCCTTACCCAGCAAGTTTGGGTCTCCCATATCAGACAATGTGCCAAGATGGAGGCCCAC

AGAAGTGGACGGAGGGAGCTGGGGCTGGTTCAGCTACCTCCCTAGCAGAGCTGCCTATGGGGCGGGGAAGGGGCTCTGCTGGGCTGAAGCCTAGACAGGG

CTCTATTTCCTGTTCCCCCCAGCATACCAGCCACTAGCGCCCCCCCCCCCCCCCGCCCTCTTCTGTGTCCTGAAGACAGGTGGCAGGGAACAGGAGGCTG

CCTCTGCCTTCTCCACATCCAGGTCCCAAGGTCACCTGGGTATTTATGAGTTTCAAATGAAGTACTGTGCCCCCAATCCAGCCCGAGCTTCCGGAAGGTT

TTCGCCATTGCTCAGGCCACCTCCAAACCCCACGTAGGTTTTATAACATGTATTATATATATATATTTTTGTGTATTTTTAAAATCCAGCTGTGATGGGC

TACATCATAAATGGCTCAAGGCAGGGGCCACTCAAGGCCTGGCTCCTGCTTTAAAGAAAAAAATTAAAAAGCTGTTTCTGGGTCAAGACAGTTGTGCCAT

ATGCAACCTTGTACCCTACCTAGTC
Translation
MQLGGLARRG - UNI14326 - - UNI20972 - GSGHPGGSGPEPKATSTIASNSWTANSSPGEAREDGSEGLDKGLDNDAEGVWSPDIEQSFQEA

LAIYPPCGRRKIILSDEGKMYG - UNI14326 - - UNI20972 - GRNELIARYIKLRTGKTRTRKQ VSSHIQVLARKKVREYQVGIK AMNL -

 UNI22133 - DQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSSSSR FWSSPPLLGQQPGPSQD DIKPFAQPAYPIQPPLPPALNS 

SYESLAPLPPAAASATASAPAWQDRTIASSRLRLLEYSAFMEVQRDPDT YSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPN

AFFLVKFW ADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVE TEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSV

LENFTILQ VVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD
Transcript ENSMUST00000019363
Sequence
GGGGAATGCAACTCGGAGGCCTCGCGCGCAGAG - UNI14326 - - UNI20972 - GCTCAGGCCATCCAGGGGGCTCAGGCCCAGAGCCCAAAGC

AACCAGCACAATAGCGTCCAACAGCTGGACCGCCAACAGCAGCCCCGGGGAGGCCCGGGAAGATGGGTCCGAAGGCCTGGACAAGGGTCTGGACAACGAT

GCGGAGGGAGTGTGGAGCCCGGACATCGAGCAGAGCTTTCAGGAGGCCCTGGCCATCTACCCGCCTTGCGGACGGCGCAAGATCATCCTGTCAGATGAGG

GCAAGATGTACG - UNI14326 - - UNI20972 - GTCGAAATGAGCTGATTGCCCGCTACATCAAGCTGAGGACTGGAAAAACCAGGACAAGAAA

ACAG GTGTCCAGCCACATACAGGTTCTAGCTCGGAAGAAGGTTCGGGAATACCAGGTTGGCATTAAG GTCTGTAGTCACTTGCAGGTTCTAGCCAGGA

GGAAGTCTCGGGAGACTCAGTCCAAGCTGAAG GCTATGAACCTG - UNI22133 - GACCAAGTCTCCAAGGACAAAGCTCTCCAGAGCATGGCATC

CATGTCGTCTGCCCAAATCGTCTCTGCCAGCGTTCTACAGAACAAGTTCAGCCCGCCCTCCCCTCTACCCCAGGCTGTCTTCTCCTCCTCCTCAAGG TT

CTGGAGCAGCCCCCCTCTGCTAGGACAACAGCCTGGACCTTCTCAGGA CATCAAGCCCTTTGCCCAGCCTGCCTACCCCATCCAGCCTCCCTTGCCACC

AGCGCTCAACA GTTATGAGTCCCTCGCCCCGCTGCCCCCAGCCGCTGCCTCAGCCACCGCCTCTGCGCCTGCATGGCAGGACCGCACCATCGCCTCCTC

CCGGCTACGCCTCCTGGAGTATTCTGCCTTCATGGAGGTGCAACGGGACCCTGACACG TACAGCAAACACCTGTTTGTACACATCGGCCAGACAAACCC

TGCCTTCTCAGACCCACCCCTGGAGGCAGTGGATGTACGACAGATCTACGACAAGTTCCCCGAGAAGAAGGGGGGGCTGAAGGAACTCTACGAGAAGGGG

CCCCCGAACGCTTTCTTCCTTGTCAAGTTCTGG GCTGACCTCAACAGCACAATCCAGGAAGGCCCTGGGGCCTTCTACGGGGTCAGCTCGCAGTACAGC

TCAGCCGACAGCATGACCATCAGCGTCTCCACCAAGGTCTGCTCCTTCGGCAAGCAGGTGGTAGAGAAGGTGGAG ACCGAGTACGCCCGCCTGGAGAAC

GGCCGCTTCGTGTACCGCATCCACCGCTCACCCATGTGCGAGTACATGATCAATTTCATCCACAAACTGAAGCATCTGCCCGAGAAGTACATGATGAACA

GTGTGCTGGAGAACTTCACCATCCTGCAG GTGGTCACAAGTCGGGACTCGCAGGAGACCCTGCTGGTCATTGCTTTTGTCTTTGAAGTCTCCACCAGCG

AGCATGGGGCGCAGCACCACGTCTACAAGCTTGTCAAAGACTAGCCAGCCCTCGACCTCCACAGGATGCAAGGCGGACATCCTCCACACACCTGCCTGCC

TGGTCTTCCCGTGTGGGTTGGGGGACCTAGCCCAGCCCCCCTGGGTTTCAGGCTGGGACCCAGGCTGCCTCCCTGGCTCCAGCACACATGCTCCCTGCCA

CTGTTCTGCGCTTTACTGGAGAGAAGAGGGCTCCACGGTGGGGTGGCTTGCTTGGGCACTGAGCCACAGATGACCAGGCTCCACCTGGCCTCAAGTGACA

CCAGAATTGTACCATGGAGGACACCTTGGGGCTTAGTGTGTGGTTGCTGGCCCCTAGGGGAATGAATGTGCTGGGCAGGTGAGGGTTGCATTGAGACTGG

GGAAAGGCAGCTTGCAAGGAGGCCCTGGTACAAGGTGTCAGGTTGGGGAGGTTGAGAAGGGCCCACACTTCTTTGTACCTTCTGGGTACCAGTCTGTTCC

CAGGTCCCTTACCCAGCAAGTTTGGGTCTCCCATATCAGACAATGTGCCAAGATGGAGGCCCACAGAAGTGGACGGAGGGAGCTGGGGCTGGTTCAGCTA

CCTCCCTAGCAGAGCTGCCTATGGGGCGGGGAAGGGGCTCTGCTGGGCTGAAGCCTAGACAGGGCTCTATTTCCTGTTCCCCCCAGCATACCAGCCACTA

GCGCCCCCCCCCCCCCCCGCCCTCTTCTGTGTCCTGAAGACAGGTGGCAGGGAACAGGAGGCTGCCTCTGCCTTCTCCACATCCAGGTCCCAAGGTCACC

TGGGTATTTATGAGTTTCAAATGAAGTACTGTGCCCCCAATCCAGCCCGAGCTTCCGGAAGGTTTTCGCCATTGCTCAGGCCACCTCCAAACCCCACGTA

GGTTTTATAACATGTATTATATATATATATTTTTGTGTATTTTTAAAATCCAGCTGTGATGGGCTACATCATAAATGGCTCAAGGCAGGGGCCACTCAAG

GCCTGGCTCCTGCTTTAAAGAAAAAAATTAAAAAGCTGTTTCTGGGTCAAGACAGTTGTGCCATATGCAACCTTGTACCCTACCTAGTC
Translation
MQLGGLARRG - UNI14326 - - UNI20972 - GSGHPGGSGPEPKATSTIASNSWTANSSPGEAREDGSEGLDKGLDNDAEGVWSPDIEQSFQEA

LAIYPPCGRRKIILSDEGKMYG - UNI14326 - - UNI20972 - GRNELIARYIKLRTGKTRTRKQ VSSHIQVLARKKVREYQVGIK VCSHLQ

VLARRKSRETQSKLK AMNL - UNI22133 - DQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSSSSR FWSSPPLLGQQPGPSQD D

IKPFAQPAYPIQPPLPPALNS SYESLAPLPPAAASATASAPAWQDRTIASSRLRLLEYSAFMEVQRDPDT YSKHLFVHIGQTNPAFSDPPLEAVDVRQ

IYDKFPEKKGGLKELYEKGPPNAFFLVKFW ADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVE TEYARLENGRFVYRIHRSPMC

EYMINFIHKLKHLPEKYMMNSVLENFTILQ VVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD

For any suggestions or comments, please send an email to unitrap@crg.es