Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002250 (Ppard)
Chromosomal location
Chr 17: 28369699 - 28438410 (+)
Description
peroxisome proliferator activator receptor delta Gene [Source:MGI (curated);Acc:Ppard-001]
RefSeq_dna
NM_011145 
RefSeq_peptide
NP_035275.1 
MGI
MGI:101884 
Uniprot/SWISSPROT
P35396 
Uniprot/SPTREMBL
Q546I3 Q7TSY1 
Human Ortholog
ENSG00000112033 (PPARD)
Omim not available
UniTrap UNI25687
Vector Insertion
Chr 17: 28369810 - 28373956
Public Clones not available
Private Clones OST170434 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8333
Vector Insertion
Chr 17: 28374041 - 28423205
Public Clones (sanger) STA117 (baygenomics) D067A10 (ggtc) E022C04 (ggtc) F047F08 (ggtc)
E066D02 (ggtc) IST10835A12 (tigm) IST11646C11 (tigm) IST14401G5 (tigm)
IST14484B8 (tigm) IST10835B12 (tigm)
Private Clones OST464680 (lexicon) OST223153 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2521
Vector Insertion
Chr 17: 28423413 - 28432285
Public Clones XS0418 (sanger) XS0888 (sanger) XG364 (baygenomics) CSJ215 (baygenomics)
CSI804 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000002320
Sequence
GCCGCAGGCCGCGGCGGACCTGGGGATTAATGGGAAAAGTTTTGGCAGGAGCTGGGGGATTCTGCGGAGCCTGCGGGACGGCGGCAGCGGCGCGAGAGGC

GGCCGGGACAG - UNI25687 - TGCTGTGCAGCGGTGTGGGTATGCGCATGGGACTCACTCAGAGGCTCCTGCTCACTGACAGATGAAGACAAACCC

ACGGTAAAG - UNI8333 - GCAGTCCATCTGCGCTCAGACCCAGATGGTGGCAGAGCTATGACCAGGCCTGCAGGCGCCACGCCAAGTGGGGGTCAG

TCATGGAACAGCCACAGGAGGAGACCCCTGAGGCCCGGGAAGAGGAGAAAGAGGAAGTGGCCATGGGTGACGGAGCCCCGGAGCTCAATGGGGGACCAGA

ACACACGCTTCCTTCCAGCAGCTGTGCAG - UNI2521 - ACCTCTCCCAGAATTCCTCCCCTTCCTCCCTGCTGGACCAGCTGCAGATGGGCTGTGA

TGGGGCCTCAGGCGGCAGCCTCAACATGGAATGTCGGGTGTGCGGGGACAAGGCCTCGGGCTTCCACTACGGGGTCCACGCGTGCGAGGGGTGCAAG GG

CTTCTTCCGCCGGACAATCCGCATGAAGCTCGAGTATGAGAAGTGCGATCGGATCTGCAAGATCCAGAAGAAGAACCGCAACAAGTGTCAGTACTGCCGC

TTCCAGAAGTGCCTGGCACTCGGCATGTCGCACAACG CTATCCGCTTTGGACGGATGCCGGAGGCCGAGAAGAGGAAGCTGGTGGCGGGGCTGACTGCC

AGCGAGGGGTGCCAGCACAACCCCCAGCTGGCCGACCTGAAGGCCTTCTCTAAGCACATCTACAACGCCTACCTGAAAAACTTCAACATGACCAAAAAGA

AGGCCCGGAGCATCCTCACCGGCAAGTCCAGCCACAACGCA CCCTTTGTCATCCACGACATCGAGACACTGTGGCAGGCAGAGAAGGGCCTGGTGTGGA

AACAGCTGGTGAACGGGCTGCCGCCCTACAACGAGATCAGTGTGCACGTGTTCTACCGCTGCCAGTCCACCACAGTGGAGACAGTCCGAGAGCTCACCGA

GTTCGCCAAGAACATCCCCAACTTCAGCAGCCTCTTCCTCAATGACCAGGTGACCCTCCTCAAGTATGGCGTGCACGAGGCCATCTTTGCCATGCTGGCC

TCCATCGTCAACAAAGACGGGCTGCTGGTGGCCAACGGCAGTGGCTTCGTCACCCACGAGTTCTTGCGAAGTCTCCGCAAGCCCTTCAGTGACATCATTG

AGCCCAAGTTCGAGTTTGCTGTCAAGTTCAATGCGCTGGAGCTCGATGACAGTGACCTGGCGCTCTTCATCGCGGCCATCATTCTGTGTGGAG ACCGGC

CAGGCCTCATGAATGTGCCCCAGGTAGAAGCCATCCAGGACACCATTCTGCGGGCTCTAGAATTCCATCTGCAGGTCAACCACCCTGACAGCCAGTACCT

CTTCCCCAAGCTGCTGCAGAAGATGGCAGACCTGCGGCAGCTGGTCACTGAGCATGCCCAGATGATGCAGTGGCTAAAGAAGACGGAGAGTGAGACCTTG

CTGCACCCCCTGCTCCAGGAAATCTACAAGGACATGTACTAAGGCCGCAGCCCAGGCCTCCCCTCAGGCTCTGCTGGGCCCAGCCACGGACTGTTCAGAG

GACCAGCCACAGGCACTGGCAGTCAAGCAGCTAGAGCCTACTCACAACACTCCAGACACGTGGCCCAGACTCTTCCCCCAACACCCCCACCCCCACCAAC

CCCCCCATTCCCCCAACCCCCCTCCCCCACCCCGCTCTCCCCATGGCCCGTTTCCTGTTTCTCCTCAGCACCTCCTGTTCTTGCTGTCTCCCTAGCGCCC

TTGCTCCCCCCCTTTGCCTTCCTTCTCTAGCATCCCCCTCCTCCCAGTCCTCACATTTGTCTGATTCACAGCAGACAGCCCGTTGGTACGCTCACCAGCA

GCCTAAAAGCAGTGGGGCCTGTGCTGGCCCAGTCCTGCCTCTCCTCTCTATCCCCTTCAAAGACATGAGCCATCCAAAGAAACACTACGCTCTCTCTGGG

CCCAGCTTTCCAAGAAGCCTGGCCTGGACCAACTGCCATCCCAGCTTGTGGTCACCACCACAGGGTTCCTCCTCCAGAGAGCAAGTGGGCAGGGAGCCTG

GGCCGGGAGCCATATTCCCAGGCTGTCTCAGCCCTAGGCACACCACTCTCTGACACTTCCTTTCTTCTCGCCGGCGTCCTAGGTCATTGTCACAGATGAC

CCTTGTGCTGCCTAGGAGATGACCCCTCCAGATGTCCCCTCCAGATGCGGTCCAACGGCCCCACTGAAGGGAAGGGGGTAGAGGCAGGCCGGAAGGAGCA

GCGGCACACTTAGGTCCCAGGGTCAGAAGCTAGACAGCGAGTGGGCAGGCCCTCCATCAGCACCCCTCCTCTACCCTGTAGCAGCATCCAGACTGGCAGA

TCCCAGTACCAGGAACTGGACCATAGCTGTTCTTTCTTCTCCTGGGAGATGCTGGCACACCTGCCCCCCCCCCCCCCTTGCAGCTGCCCCGGTGTAGCCA

TGACACTGGCTCACCTCTCGGTCACCACAGAGTCCCTCCCATTCCCTCCCCAAGGCCACTGGGGTACAGCTATGGCCCTGTTCTTAGGACTGGTGATCTG

TGAGCAGGCAGGGATATCCTACCAGGTCACCCCTGCCAGCTCACAGGCAGAGTTGCTAGGGTTCCTCTGACCCTGTCCTCTCTCCCACTCACTTGTACCA

GTAGCTCTGTGGCCTTCTCTTCTTTTGCCTGGCTGGTCACCTGCTCCCATCTGCTGCTTCAAGTGGCTTGAAACTTGCTGGGTGCTCCCATACTCAGCCC

CAGCCCGGCAGATCCTGCCTCTAGGCCCATAGGTGATCAGCCCAGGCTCGGCTCCTGCCAACACAGAATGCTGCCAGATTCCCCGCTAGCACACTCCCTG

CCCCTCACCTCTACTGATCAGGTCTTGGGGTGTTCCTTGTGGGGCCCACCCAGGCTGAGAATGGAGCTACATCACCCGCCCTGCCCCCACCTGCCCAGCC

CCGCCCAGGTCTGGTGCTGAGGATGCAGCTCCTCTCAGGGTCTGAAGTCTCCAAATCTGAAATGTATATTTTTGCTAGGAGCCCCAGCTTCCCGTGTTTT

TAATATAAATAGTGTATACAGACTGACGGAACTTTAAATAAATGGGAATTACGTATTT
Translation
 - UNI25687 -  - UNI8333 - MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCAD - UNI2521 - DLSQNSSPSSLLDQLQM

GCDGASGGSLNMECRVCGDKASGFHYGVHACEGCK GFFRRTIRMKLEYEKCDRICKIQKKNRNKCQYCRFQKCLALGMSHNA AIRFGRMPEAEKRKLV

AGLTASEGCQHNPQLADLKAFSKHIYNAYLKNFNMTKKKARSILTGKSSHNA PFVIHDIETLWQAEKGLVWKQLVNGLPPYNEISVHVFYRCQSTTVET

VRELTEFAKNIPNFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAII

LCGD DRPGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLLQKMADLRQLVTEHAQMMQWLKKTESETLLHPLLQEIYKDMY

For any suggestions or comments, please send an email to unitrap@crg.es