Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002280 (Narfl)
Chromosomal location
Chr 17: 25910745 - 25920277 (+)
Description
nuclear prelamin A recognition factor-like Gene [Source:MGI Symbol;Acc:MGI:1914813]
RefSeq_peptide
NP_080514.2 
MGI
MGI:1914813 
Uniprot/SWISSPROT
Q7TMW6 
Human Ortholog
ENSG00000103245 (NARFL)
Omim not available
UniTrap UNI15845
Vector Insertion
Chr 17: 25912087 - 25913910
Public Clones not available
Private Clones OST471845 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000002350
Sequence
ACTCGGCGGCAGTGAGGCTGTCATGGCGTCGCCCTTCAGTGGGGCACTACAGCTGACCGACTTGGACGACTTCATCGGGCCATCTCAG AATTGCATCAA

GCCTGTAAAGGTGGCTAAGAAGCCAGGAAGTGGCATAGCCAAGATCCACATTGAAGACGATGGCAGTTACTTCCAAGTGAACCAA - UNI15845 - G

ACGGAAGAACCCAGAAGCTGGAGAAGGCCAAGGTCTCCCTGAATGACTGCCTGGCGTGCAGCGGCTGTGTCACCTCAGCAGAGACAGTACTCATCACCCA

GCAGAGTCACGAGGAACTGCGGAAGGTTCTAGATGCTAATAAG GAGGCAGCACCTGGTCAGCAGCGGCTGGTGGTCGTTTCCATATCGCCGCAGTCCAG

AGCATCACTGGCTGCCAGGTTTCGGCTGGACCCCACAGACACTGCCAGGAAATTAACTTCATTCTTCAAAAAAATAG GGGTCCACTTTGTCTTTGATAC

TGCCTTCGCGAGGAACTTCAGCCTTTTGGAAAGCCAAAAAGAGTTTGTGCAGCGCTTCCGAGAGCAAGCCAACTCCAGAGAGGCCTTGCCTGTGCTGGCT

TCCGCCTGCCCAG GCTGGATCTGCTATGCTGAGAAGACACATGGCAACTTCATCCTCCCCTACATCAGTACAGCCCGGTCCCCACAGCAGGTTATGGGC

TCCCTGGTCAAAGACTTCTTCGCACAACAGCAG CTTCTGACTCCTGACAAGATCTACCATGTAACAGTGATGCCCTGCTATGATAAAAAGCTAGAAGCA

TCCAGACCTGACTTCTTCAACCAGGAGTACCAGACCCGTGATGTGGACTGTGTCCTTACAACAG GAGAAGTCTTCAGGCTGCTGGAGGAAGAAGGAGTC

TCCCTCACGGAGCTGGAGCCTGCGCCCCTGGATGGCTT AACCAGTAGTGTGTCTGCTGAGGAGCCCAGCAGCCATCGGGGCGGAGGCTCAGGAGGCTAC

CTGGAGCATGTGTTCCGGCACGCAGCCCAAGAGCTCTTTGGAATCCACGTGGCTGAAGTCACCTATCAACCCTTGAG GAACAAGGACTTCCAGGAAGTG

ACACTGGAAAGGGAAGGCCAGGTACTGTTGCGCTTTGCTGTGGCCTATGGTTTCCGTAATATCCAGAACCTCGTGCAGAAGTTGAAACGAGGCCGCTGTC

CCTACCATTACGTGGAAGTAATGGCCTGCCCTTCAG GTTGCTTGAATGGAGGGGGCCAGCTCAAGGCTCCGGATACAGAGGGCAGCGAGCTCCTTCAGC

AGCTGGAAAGACTGTACAGCATGGTGAGGACTGAGGCGCCCGAAGATGCACCGGGGGTCCAGGAGCTGTACCAGCACTGGCTGCAAGGAGAGGACTCAGA

GCGGGCCAGCCGCCTGCTGCACACACAATACCATGCCGTGGAGAAGCCCAGCTCAGGCCTGAGCATCAGGTGGTAGGAGGCCTTGAGTCTGTGAGACCCC

CGGGGCCAGCACCAAGACTCACGGAAAGACTAGACTGTGTGGGTATCTGAAACAAAGCCCACAGGATACGCCCGAGACCCTCAATTCAAGGAGAGCTCCA

AGGATGTGTTGGACTCTGTGCTCCAGTGGGGCACTGGCTGCACGTGGGTCCTTGGAGATGCGTGACCCATGTCTCTGGCTGGTAATGTTGCCTGCAGCCC

ACATAAAGTGCAGGCAGGATCAGAAGTAGCCAAGTAGGTTCACTGAGGTTCCAGACTCTTCCACTGGCCTGGGGCCATGGACATCTTGTGAGCCCTGCCC

TCTGGCTGTAGTTGTCTGAGTGTGAGGGGTTTCATTTCTATGGCTAATCCCCAAAGCTGTAACACATAGGGCAGGTACCTACTGAGGCACCCAGGCTTCT

AAAAACTGTTCTCAGGACCTTGGGCTCTGGGCAGTCTGTCAGTACCAAGCCTTTATGCCTATGAGAACTCCATAGCTGGGTCTCACCACTAATAAACAGA

CCTGCACCTCTGGAAGGATCCACTGTGTGTCTGGTACCACACTGGGCCTTTCAAAGTTTTATTCACCCTCCTCAGTCCCCAGGATATGTCTCTGGACCCA

CAAGAGCTCCTACAGATCCCACTTATAGGGCTCCATGAGCAGTAGAGACAAGACACCACTTGCTGGTTCTTCAAAGCAGGGTGGCAGGGGTCCCTGGGGG

AGTGTGGGGACAAGCCGGTTCCCCACATAGTTCACTTTTTCTGGTGTGTGCTCAGAAGCCCCCACTGTAAGGCCAGGAGTGCCCGAACCTGCGGCTGTGG

TGGCTCCACAGCAGGCTGGAAGCGCGCTCGCTCCCTGCAGAGGGCCTCCAGGACCTGGGCTGGGGCCACCTGGCCTGTGAACGCACGGACTGCATCCTCT

CTGCAGGGAAGAATATGCTGGGGAATTGTGGGGCTGGCCAGCTGCCCATGGGGGTGGGGCCCAGCAGGGCGGTGGATGGAAGGAGGGCCCTTAATAAATG

ACCTTCTCTGGTGCCAGGGACATTCAGCTCAATAAATAGTCCCTAGATACCCTC
Translation
MASPFSGALQLTDLDDFIGPSQ NCIKPVKVAKKPGSGIAKIHIEDDGSYFQVNQ - UNI15845 - DGRTQKLEKAKVSLNDCLACSGCVTSAETVL

ITQQSHEELRKVLDANK EAAPGQQRLVVVSISPQSRASLAARFRLDPTDTARKLTSFFKKIG GVHFVFDTAFARNFSLLESQKEFVQRFREQANSREA

LPVLASACPG GWICYAEKTHGNFILPYISTARSPQQVMGSLVKDFFAQQQ LLTPDKIYHVTVMPCYDKKLEASRPDFFNQEYQTRDVDCVLTTG GEV

FRLLEEEGVSLTELEPAPLDGL LTSSVSAEEPSSHRGGGSGGYLEHVFRHAAQELFGIHVAEVTYQPLR RNKDFQEVTLEREGQVLLRFAVAYGFRNI

QNLVQKLKRGRCPYHYVEVMACPSG GCLNGGGQLKAPDTEGSELLQQLERLYSMVRTEAPEDAPGVQELYQHWLQGEDSERASRLLHTQYHAVEKPSSG

LSIRW

For any suggestions or comments, please send an email to unitrap@crg.es