Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002319 (Ipo4)
Chromosomal location
Chr 14: 56244466 - 56254515 (-)
Description
importin 4 Gene [Source:MGI (curated);Acc:Ipo4-001]
RefSeq_dna
NM_024267 
RefSeq_peptide
NP_077229.4 
UniGene
Mm.466446 Mm.474981 
MGI
MGI:1923001 
Uniprot/SWISSPROT
Q8VI75 
Uniprot/SPTREMBL
O89081 Q5U4C5 
Human Ortholog
ENSG00000196497 (IPO4)
Omim not available
UniTrap UNI25570
Vector Insertion
Chr 14: 56253247 - 56253841
Public Clones not available
Private Clones OST176374 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047131
Sequence
GGAGTCTCCACGTGCCGATCCTCCCCCTCCCCACCCGGCCCTGTAGCAGCGGCGGCGTCGGCGGCGGCTCGGCAGCTGCCATGGAGCCTGCGGGTTTGGA

ACAGATCCTGAAGGAGCTGCTGCTGCCCGACACGGAGCGCATCCGCCGG GCTACGGAGCAGCTCCAGACCATCCTTCGGGACCCTGCTGCCTTGCCCGC

ACTCTTCGATCTGCTGGCAACAGCGACCGACTCTCAG ATCCGCCAGTTTGCAGCGGTCCTGACCCGCAGAAGGCTGAACAATCGCTGGCGACGCCTGGC

ACCTGAGCAGAGGGAGAG CCTCAAGTCCCTGGTCCTGACAGCACTGCAGAAAGAGACAGT - UNI25570 - GCATTCTGTGAGTGTCAGCTTGGCC

CAGCTCTCAGCCACCATTTTTCGAAAGGAAGGCCTACAAGGATGGCCTCAGTTCATGAACCTTCTTCAGCACAGCACTCATAGTTCCCATAGCCCCGAGA

AAGAG GTGGGACTTCTGCTGCTGAGTGTGGTGGTGTCTTCCCAGCCCGAGGCATTCCATGCCCACCAGCACGAGCTGCTTCAGCTTCTGAATGAGACGC

TCAGTGACGTCAGCTTTCCCGGAGTGCTCTTCTACTCCCTGCGCACTCTGACTGCCATCGCCCGCTATGTCAGGCCGGATGATGTG TCTCTTGCACGGA

TGTTGGTGCCCAAAGTCGTTACGGCACTGAGGACTCTGATCCCCTTAGATGAG GTAAAGGCCTGTGAGGCCCTGGAGGCCCTGGATGAAATGCTGGAGA

CAGAGTTGCCCATCATCAACCCCCACCTCTCTGAGGTCCTCACGTTTTGCCTGGAG GTGGCTAAGAATGTGGCCCTTGGCGAACCACTCCGCGTACGTG

TTCTCTGCTGCCTCACTTTCTTGGTCAAAGTCAAAAGTAAG GCCTTACTAAAGAACCGCCTCGTGCCTCCCTTGCTGCACGCCCTTTTCCCCCTCATGG

CTGCTGAGCCACCCATGGGCCAACTGGATCCTGAAGATCAAGATTCGGATGACGATGACTTGGAGATCGGGCTGATGGGGGAGACTCCCAAGCACTTTGC

TGTACAG GTTGTGGACATGCTGGCACTACATCTTCCCCCTGAGAAGCTCTGTCCCCATGTG ATGCCCATGCTGGAAGAAGCCTTGCGGAGCGAGGACC

CATACCAGCGCAAAGCAGGATTCCTGGTGTTGGCTGTGCTGTCTGATGGTGCAGGCGACCACATCAGGCAGAG ACTGCTGTACCCACTGCTACAGATTG

TGTGCAAGGGCCTGGATGACCCCTCACAGATTGTTCGTAATGCTGCTCTGTTCGCCCTGGGCCAGTTTTCAGAGAACTTACAG CCCCATATCAGCAGCT

ACTCTGAGGAGGTGATGCCCCTTCTCCTCTCCTACCTGAAGTCAGTGCCGATGGGAAACACACACCACCTGGCCAAGGCCTGCTATGCTCTGGAGAATTT

TGTGGAGAACCTAG GGCCCAAAGTGCAGCCCTACCTTCCGGAGCTTATGGAATGTATGCTGCAGCCATTGAAGAACCCCAGCAAAGCCCGGACCAAGGA

GCTAGCTGTGAGCGCCATAGGGGCCATTG CCACAGCGGCCCAGGATTCCCTGCTGCCCTACTTCCCTACCATCATGGATCTTCTCCGGGAGTTCTTGTT

GACAGGCCACGAAGACTTTCATCTTGTGCAGATCCAGAGCCTGG AGACCCTGGGAGTGCTAGCACGAGCCCTGGGAGAGTCCATGAAGCCCCTGGCTGA

GGAATGCTGTCAGCTTGGGCTAGGGTTATGCATCCATATAGATGACCCTGACGTGAGGCGCTGCAC GTACAGCCTGTTTGCAGCCTTATCAGGGTTAAT

GGGAGAGGGCTTGGGACCCTACCTGCCTCAGATTACCACGCTCATGCTGCTGTCGCTGCGCTCCACTGAGGGCATTGTG CCACAGTATGACGGGATCAG

CTCCTTCCTGCTGTTTGATGACGACAGCGAAGCAGAAGAGGAGGAGGAGCTCATGGATGAAGATATGGAAGAGGAGGGGGATGACTCTGAGATCTCGGG 

GTATAGTGTGGAGAATGCCTTCTTTGATGAGAAAGAAGACACCTGCACCGCCCTGGGGGAGATCTCCATGAACACCTG TGTGGCTTTTCTCCCATTCAT

GGATGCCACCTTCGATGAAGTATACAAACTGCTGGAG TGCCCTCATATGAATGTGCGGAAGTCAGCTTACGAAGCGCTGGGACAGTTCTGCTGTGCACT

GCATAAGGCCTCTCAGAGAAGCTCCTCAGATCCCAGCAGCAGTCCCG TTCTGCAGACCTCCCTGGCTCGAGTGATGCCAGCTTACATGCAGGCCGTGAA

AGTAGAAAGGGAGCGCCCAGTGGTGATGGCCGTGCTGGAGTCCCTGACAGGGGTGCTGCGCACCTGCGGCAGCCTTGCACTGCAGCCTCCTGGGCGGCTC

AGTGAGCTCTGCAACGTGCTCAAGGCTGTGCTGCAGAAAAAG ACGGCCTGTCAGGACGCCGAGGAGGATGATGACGAAGATGATGACCAG GCAGAGTA

TGACGCCATGTTACTAGAACATGCTGGAGAGGCCATTCCCGTCCTGGCAGCCACAGCTGGAGGACACGCCTTCGCTCCCTTCTTTGCCACGTTCTTGCCA

TTGTTGCTGTGTAAGACG AAACAGAGCTGTACAGTGGCAGAGAAGTCCTTTGCTGTGGGAACCCTGGCAGAGTCCATTCAGGGTCTAGGGACCGCCTCA

GCCCAGTTTGTGTCTCGGCTGTTCCCTGTGCTGTTAAACAATGCCCGGGAAGCAGACCCTGAGGTGCGGAGCAATGCCATCTTTGGGTTGGGCGTACTGG

CAGAGCATGGCGGCTGCCCTGCTCAGGA CCACTTCCCTAAGCTACTGGGCCTCCTTTTGCCCCTGCTGGCAAGGGAGCGACATGATCGAGTCCGTGATA

ACATCTGCGGGGCTCTTGCCCGTGTACTGATGGCCAGTCCAGTAGGAAAAACGGAGCCCCAG GTGCTGGCTACCCTGCTACGTGCCCTGCCCCTGAAGG

AAGACATGGAGGAGTGGCTCACTATAGGTCACCTCTTCAGCTTCCTGCACCAGAACAATCCTGAGCAG GTTGTGGATGTGGCTTCAGAACTCCTGCGCA

TCTGCAGCCTGATCCTGCCGGACAACCGGATCCCTCCAG ACACCAAGGCGGCCCTGCTGCTGCTCCTGACGTTCCTGGCCAAGCAGCACACCGACAGCT

TCCACACAGCCCTGGGCTCTCTGCCAAATGATAAAGCTCAGGAACTTCAGGCCATGATGGGCCTCACTTAAGACTATAGGCCACAGGGGCCAGGGGTCCG

AAGACCGAGGTCAGCCCTGGTCCAGTTCACCTTACCAAAGACTCTATCCATTGAAGTCAACTGTGCTGTTTTAACAGGGGTGTCTCTGGGGCTGGACATC

ATACTATAATAAAGCAGAGCTGTGACATCATACTATAATAAAGCAGAGCTGTGACATCATACTATAAGGAAGCAGCTGTGACGTCATACTATAAGAAAGC

AGAGCTGTGACGTCATACTATAATAAAGGTGGCCTGTCTTCTGCTTGGACACT
Translation
MEPAGLEQILKELLLPDTERIRR ATEQLQTILRDPAALPALFDLLATATDSQ IRQFAAVLTRRRLNNRWRRLAPEQRES SLKSLVLTALQKETV - 

UNI25570 - VHSVSVSLAQLSATIFRKEGLQGWPQFMNLLQHSTHSSHSPEKE VGLLLLSVVVSSQPEAFHAHQHELLQLLNETLSDVSFPGVLFYS

LRTLTAIARYVRPDDV SLARMLVPKVVTALRTLIPLDE VKACEALEALDEMLETELPIINPHLSEVLTFCLE VAKNVALGEPLRVRVLCCLTFLVKV

KSK ALLKNRLVPPLLHALFPLMAAEPPMGQLDPEDQDSDDDDLEIGLMGETPKHFAVQ VVDMLALHLPPEKLCPHV MPMLEEALRSEDPYQRKAGFL

VLAVLSDGAGDHIRQR RLLYPLLQIVCKGLDDPSQIVRNAALFALGQFSENLQ PHISSYSEEVMPLLLSYLKSVPMGNTHHLAKACYALENFVENLG 

GPKVQPYLPELMECMLQPLKNPSKARTKELAVSAIGAIA ATAAQDSLLPYFPTIMDLLREFLLTGHEDFHLVQIQSLE ETLGVLARALGESMKPLAEE

CCQLGLGLCIHIDDPDVRRCT TYSLFAALSGLMGEGLGPYLPQITTLMLLSLRSTEGIV PQYDGISSFLLFDDDSEAEEEEELMDEDMEEEGDDSEIS

G GYSVENAFFDEKEDTCTALGEISMNTC CVAFLPFMDATFDEVYKLLE CPHMNVRKSAYEALGQFCCALHKASQRSSSDPSSSPV VLQTSLARVMP

AYMQAVKVERERPVVMAVLESLTGVLRTCGSLALQPPGRLSELCNVLKAVLQKK TACQDAEEDDDEDDDQ AEYDAMLLEHAGEAIPVLAATAGGHAFA

PFFATFLPLLLCKT KQSCTVAEKSFAVGTLAESIQGLGTASAQFVSRLFPVLLNNAREADPEVRSNAIFGLGVLAEHGGCPAQD DHFPKLLGLLLPLL

ARERHDRVRDNICGALARVLMASPVGKTEPQ VLATLLRALPLKEDMEEWLTIGHLFSFLHQNNPEQ VVDVASELLRICSLILPDNRIPPD DTKAALL

LLLTFLAKQHTDSFHTALGSLPNDKAQELQAMMGLT

For any suggestions or comments, please send an email to unitrap@crg.es