Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002324 (Rec8)
Chromosomal location
Chr 14: 56237007 - 56244226 (+)
Description
REC8 homolog (yeast) Gene [Source:MGI (curated);Acc:Rec8-001]
Human Ortholog
not available
Omim not available
UniTrap UNI38461
Vector Insertion
Chr 14: 56244017 - 56244112
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000002395
Sequence
TCAACGACGACGACTACGGCGGCGGCGGCGGTGGTGGTGGTGGTGGTGGTGGTGGTGGCGGGCAGCAGAGTCGAAGAAGGCCTCTTGACCAGAAGAGGAC

TCAGTCTTCTTTGAAGATCTGTTCTGTGTCTCTGCCCGGGTTTTTCTTGGAGCTCCGCATCTCTGCCTGGACAGAATCCTGATG AATTCGGATTGAGAT

CCAAACGGGATTGGTGCAGGGAAGGTGAACCCAGGAGCAAAGATGTTCTACTATCCTAACGTGCTTCAGCGCCACACAGGCTGCTTCGCCACCATCTG G

CTGGCAGCAACCCGAGGCAGCCGTTTGGTGAAGCGTGAATACCTAAATGTGAATGTGGTAAAGACCTG CGAGGAAATCCTCAATTATGTGCTGGTAAGA

GTGCAACCTCCGGTGGCCGGGCTGCCCCGCCCCCGCTTCTCCCTCTATCTCTCCGCCCAGCTTCAGATTGGTGTGATAAGGGTCTACTTTCAACAGTGCC

AGTACCTTGTGG AAGACATCCAGCATATCCTGGAGCACCTACATCGTGCCCAGCTGCGGATTCGCATTGATATGGAGGAGGCTGACCT ACCTAGCTTG

CTTCTTCCCAACTGCCTGGCCATGATGGAGACGCTGGAAGATGCCCCAGAACCCTTTTTTGGGAAGATGTCTGTGGATCCTAGACTTCCCAGTCCTTTTG

ATATTCCTCAG ATTCGACACCTTTTAGAGGCTGCAACCCCGGAAAAAACTCGTAAGGAGACCCTTCCTGAAGCCACTCCAGACCCCAGGAAGCCTG AC

AGGACCTTGGCCACCGTGCAGTCCCCTGAGGTCATCACCTTACAGGAGGCAGAGCCCATCCGCATGCTGCAGATTGAA GGAGAGCAGGATCTCCCAGAG

ATCAGTCGAGGAGACTTAGAACTGCTGATCGCAGAGAAAGATGACGCCATCTTGCTAGAGGAACGTCAGAGAGGCAGGCTTCTCCGACAGCGGAGAGCTT

CACTACCACTGGATG AATCCAGGGAAGAACCCCGGGCCCTAGAAGGTGCTGGTTTGGTCTCGGCACTCTCACCTCCAGCTCCTGCGCA GGTGGAAGGG

ATACAAGAAGCACTACCAGGCCAGGTCTTCCCTCCTGAGGTACAGAAGATGACAGGCTGGGAGCCTGGGGCCCTACTCACTG AGGTGACCCCACCTCAG

GAGCTGCGGCTGCCTGCCCCACCCAGTACAGAG AAGAGGCTCCCGTCTCTTCAGAGGCCACTTCCCCGCCGACACCGGCGGCGCCAGTTATTATTCTGG

GACAAGGAGACCCAGATCTCTCGGGAGAAGTTTGAGGAACAACTGCAGACTGGGGCTCACTGCTGGGAGTAT CCAGTGGCCCAGCCTCCCAAGAGGATG

CTCACAAGCCCAGCGGAGCTCTTCAGAACCCCAACTCTCT CTGGCTGGCTACCCCCAGAACTCCTAGGTTTATGGACACACTGTGCCCAGGTCCCCCAA

AGAATGCTCAGACAAAGGCCACAGCTGGAGACTGAGGAGACAGTGGAGGAAGAGAGAGCAGCAGATGAGGAAGAGAGGAGAAAGACTGAAGCTCTGAGCG

AGATCGAG GTTCTGAGGGAGGCCCAGGAGCCCAGTGGTCCCCTCATGCTGTCTTCAG AGCTCTCCCTAGAAGCAGCAGAAGATGAAAAGTCTCGTACT

AGCCTCATCCCCCCAGAATGGTG GGCCTGGTCTGAGGAGGGGCAGCCCGAGCCCCCTGCACTGCCCATGCTGCCTGAACTTCCTGAAGTGCCCATGGAG

ATGCCCCCAAGGCCTGAACTCTCTTCAGAGGCTGTGCTCAG GGCAGTAGCACTGAAACTGCAGGCCAACAAGGAGCTGGACTTCAGCAGCCTGGTGCCC

CCTCTCAGCCCCCGAAAGTTGGCTTCTCGGGTCTTCTATCTGCTCTTGG - UNI38461 - TGCTGTCCACACAGAAGATCCTTCTTGTGGAACAACA

GAAGCCATATGGGCCCCTCCTGATTCGTCCTGGACCCAAATTCCCCTGAGCAAGTTCATTAAACCATATCCTGCCTC
Translation
 MFYYPNVLQRHTGCFATIW WLAATRGSRLVKREYLNVNVVKTC CEEILNYVLVRVQPPVAGLPRPRFSLYLSAQLQIGVIRVYFQQCQYLVE EDIQ

HILEHLHRAQLRIRIDMEEADL LPSLLLPNCLAMMETLEDAPEPFFGKMSVDPRLPSPFDIPQ IRHLLEAATPEKTRKETLPEATPDPRKPD DRTLA

TVQSPEVITLQEAEPIRMLQIE GEQDLPEISRGDLELLIAEKDDAILLEERQRGRLLRQRRASLPLDE ESREEPRALEGAGLVSALSPPAPAQ QVEG

IQEALPGQVFPPEVQKMTGWEPGALLTE EVTPPQELRLPAPPSTE KRLPSLQRPLPRRHRRRQLLFWDKETQISREKFEEQLQTGAHCWEY PVAQPP

KRMLTSPAELFRTPTLS SGWLPPELLGLWTHCAQVPQRMLRQRPQLETEETVEEERAADEEERRKTEALSEIE VLREAQEPSGPLMLSSE ELSLEAA

EDEKSRTSLIPPEWW WAWSEEGQPEPPALPMLPELPEVPMEMPPRPELSSEAVLR RAVALKLQANKELDFSSLVPPLSPRKLASRVFYLLLV - UNI

38461 - VLSTQKILLVEQQKPYGPLLIRPGPKFP

For any suggestions or comments, please send an email to unitrap@crg.es