Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002372 (Ranbp3)
Chromosomal location
Chr 17: 56812807 - 56851184 (+)
Description
RAN binding protein 3 Gene [Source:MGI Symbol;Acc:MGI:1919060]
RefSeq_dna
NM_027933 
RefSeq_peptide
NP_082209.1 
MGI
MGI:1919060 
Uniprot/SWISSPROT
Q9CT10 
Uniprot/SPTREMBL
A6H6I9 
Human Ortholog
ENSG00000031823 (RANBP3)
Omim not available
UniTrap UNI6726
Vector Insertion
Chr 17: 56812835 - 56824963
Public Clones (sanger) RHA200 (baygenomics) E032D01 (ggtc) D015D12 (ggtc) D181B09 (ggtc)
D028H06 (ggtc) IST14496G8 (tigm) IST10465C3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1042
Vector Insertion
Chr 17: 56825427 - 56825485
Public Clones AY0347 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29360
Vector Insertion
Chr 17: 56825485 - 56836024
Public Clones Ayu21-T115 (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12719
Vector Insertion
Chr 17: 56836213 - 56840445
Public Clones W015G12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8302
Vector Insertion
Chr 17: 56846662 - 56847273
Public Clones RRF315 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15151
Vector Insertion
Chr 17: 56847377 - 56847593
Public Clones PST12156-NL (escells) PST5885-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4943
Vector Insertion
Chr 17: 56847704 - 56848636
Public Clones AP0656 (sanger) PST11187-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17634
Vector Insertion
Chr 17: 56848758 - 56849510
Public Clones (sanger) E021G10 (ggtc) PST16195-NR (escells) IST10730B10 (tigm)
Private Clones OST439230 (lexicon) OST360955 (lexicon)
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16363
Vector Insertion
Chr 17: 56849654 - 56850013
Public Clones not available
Private Clones OST462342 (lexicon) OST458541 (lexicon)
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15249
Vector Insertion
Chr 17: 56850201 - 56850278
Public Clones PST10264-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112973
Sequence
CTTGCCAGTCTGGCGGGTAAT - UNI1042 - GAAAAGCCTGCCGTCGCACCGTCTGTCTTTGTGTTTCAAAAGGACAAAGGACAGAAG - UNI104

2 - - UNI29360 - AGATCTGCTGGCAGCTCCAGTCCCGAAGCCGGAGAAG ATTCTGACCATGAGGATGGAAACTACTGCCCCCCTGTCAAGCGTG

AGCGGACATCCTCTCTAACTCACTCAG - UNI12719 - AAGAGAAGAGCAGCGGCTTCCGGCTGAAGCCCCCAACACTCATCCACGGTCAGGCACCC

AGTGCAG GTCTGCCCAGCCAGAAACCCAGGGAACAGCAGCGTGGTGTGCTCCGTCCAGCTGTGCTGCAGGCCCCTCAGCCCAAGGTGCTGTCGCAGACG

G TTCCCAGCAGTGGCACCAATGGAGTCAGTATGCCAGCAGACTGCACGGGGCCAGCAACGTCTGTATCACCAGAAAACCTCACGCAGAGGAGTCCCTCT

GAGTCTGCCGAGGAGACACACACACTCGAG GAGAAGGTGCCTCAGAAAACCCCACATGGCACCTCAGAGGAGGGGCACTGTGAAGAGGAGCAGGCGGCC

CCACAGGCCTTTGTGTTTGGACAGAACTTGAGAGACAGAGTGAAG TTAATGAATGAGAATGCCAGCGTGGCAGATGTAGACAGTGCTGCACATCCCAGC

TCAGAAACACCCTCTGCGACCAACTACTTCCTTCAGTACATCAGTTCCAG CGCAGACAACGCGACCCACAGTGCTGACAACTCCACCAAGTTTGTGTTT

GGCCAGAACATGAGTGAGCGCGTCTTG - UNI8302 - AGCCCCCCAAAGCTGAATGAAGCCAATTCAGACACCAGCAGGGAGACTACACATGCCCAG

TCAGGTTCTGAGTCGTCATCCCAGGAGGCCGCCCCCAAGAAAG - UNI15151 - AGTCCCTGGCAGAGTCAGCCGCTGCCTATACAAAGGCTACAGC

GTGGACGTGTTTGCTGGAGAAGGTGGAGGTCATCACGGGGGAGGAGGCAGAGAGCAATGTGCTGCAG - UNI4943 - ATCCAGTGTAAGCTGTTTGT

GTTCGATAAGACCTCACAGTCATGGGTGGAGCGTGGCCGGGGACTTCTCAGGCTCAATGACATGGCGTCAACCGACGATGGCACATTACAGTCCCGGCTA

G - UNI17634 - TGATGCGGACCCAGGGCAGCCTGCGGCTCATCCTGAACACGAAGCTGTGGGCACAGATGCAGATGGATAAGGCCAGTGAAAAGAG

CATCCGCATCACAGCCACCGACGCTGAGGACCAGGGTGTCAAGGTTTTCCTGATCTCG - UNI16363 - GCCAGCTCCAAAGACACAGGCCAACTGT

ATGCTGCACTGCACCACCGCATCCTGGCTCTGCGTAGCCGGGCTGAACAGGAACAGGAGGCCAAGGCGCCCCCACCTGAGCCAGGAGCCACCCGGGCCAC

CGAGGAGGAAGACAGTGATGAGGATGCTGTTCTGGCTCCCTCCGGTGTCACGGGGGCTG - UNI15249 - GCACAGGTGATGAAGGAGATGGCCAGG

CTCCTGGGAGCACATAGCGGCGGAGCCACTGCACCAGGCTGCTGCTTTGTTGTCTGTCTGCTGCCCGTCCCTCCCTGCAGGCCGCATCATGGTGGTGTCT

ATTGCCGGGGTGGCCACAGGCTGGATCCGAGTGTCCCCTCTGCAGCAGACGGGGACGCCAGGATGCGGCTTGGGACTCAGACCTCATCATATTGATGAGT

AGAAAGAACGTTCCCCCGCCCTCCTCCGATCGAAATGGCACATTGACACTTGTCACAGCTTCGTGGTGACCGTCCATCCCTGGGCAGCAACAAAGAGAAC

TCCAGGCTCAGCATTCTGTTGAGTAACTTGCTACCTGCTCGGCTTTCCACTCTGCCAGGTCCACATGGCAGGTGCCTCTCCTTCATTTCTGGTGGCTTGG

CTCTTGAGGTCACAGATGAAGCTACACGTGGGCTGAGCTGACTTGATGCTCCTATGGGTGGTGCCCGGCCCCCACGGGGGTTCACTAGGTTTGGGCCTGA

GAACACCTGTCTGGACAAAGGTGATGAAACCAAGAGAGCTCCTGCCTTCTTGCCTGCCTACGTGAACCACCTGGGTCTCCCTTAGCAGGTACCCAGCCCT

GAGGTGACTGACCACCTAGGGCCCCTGAGAGGCAAAGGGAACCTGCAAAGGGCCTGTCCCCGGGCAGAAGATGAAGCCCCTACCCGTGGACTGTGTGGTT

CCATCTCTGGCCAGGCCACTTCCAGCCAGCAAGGACACCAGAGGCTGCCTTAGCAGATGGGTCACACTGCTTCCAGCCTTAGCCAGCCAGTGACAAGTGA

ATCCAGACGTCACCCATGTGTTTTGGAACATTTATGTAAGATTGAAATGTATTTGAGAACTGCATTAAAACTTTTAACT
Translation
LASLAGN - UNI1042 - EKPAVAPSVFVFQKDKGQK - UNI1042 - - UNI29360 - RSAGSSSPEAGED DSDHEDGNYCPPVKRERTSSL

THSE - UNI12719 - EEKSSGFRLKPPTLIHGQAPSAG GLPSQKPREQQRGVLRPAVLQAPQPKVLSQTV VPSSGTNGVSMPADCTGPATSVSPE

NLTQRSPSESAEETHTLE EKVPQKTPHGTSEEGHCEEEQAAPQAFVFGQNLRDRVK LMNENASVADVDSAAHPSSETPSATNYFLQYISSS SADNAT

HSADNSTKFVFGQNMSERVL - UNI8302 - SPPKLNEANSDTSRETTHAQSGSESSSQEAAPKKE - UNI15151 - ESLAESAAAYTKATAWTC

LLEKVEVITGEEAESNVLQ - UNI4943 - IQCKLFVFDKTSQSWVERGRGLLRLNDMASTDDGTLQSRLV - UNI17634 - VMRTQGSLRLILN

TKLWAQMQMDKASEKSIRITATDAEDQGVKVFLIS - UNI16363 - ASSKDTGQLYAALHHRILALRSRAEQEQEAKAPPPEPGATRATEEEDSDED

AVLAPSGVTGAG - UNI15249 - GTGDEGDGQAPGST
Transcript ENSMUST00000002445
Sequence
AGTAAAATGGCGGACCTGGCGAACGAAG - UNI1042 - - UNI6726 - AAAAGCCTGCCGTCGCACCGTCTGTCTTTGTGTTTCAAAAGGACAAA

GGACAGAAG - UNI1042 - - UNI29360 - AGATCTGCTGGCAGCTCCAGTCCCGAAGCCGGAGAAG ATTCTGACCATGAGGATGGAAACTACT

GCCCCCCTGTCAAGCGTGAGCGGACATCCTCTCTAACTCACTCAG - UNI12719 - AAGAGAAGAGCAGCGGCTTCCGGCTGAAGCCCCCAACACTC

ATCCACGGTCAGGCACCCAGTGCAG GTCTGCCCAGCCAGAAACCCAGGGAACAGCAGCGTGGTGTGCTCCGTCCAGCTGTGCTGCAGGCCCCTCAGCCC

AAGGTGCTGTCGCAGACGG TTCCCAGCAGTGGCACCAATGGAGTCAGTATGCCAGCAGACTGCACGGGGCCAGCAACGTCTGTATCACCAGAAAACCTC

ACGCAGAGGAGTCCCTCTGAGTCTGCCGAGGAGACACACACACTCGAG GAGAAGGTGCCTCAGAAAACCCCACATGGCACCTCAGAGGAGGGGCACTGT

GAAGAGGAGCAGGCGGCCCCACAGGCCTTTGTGTTTGGACAGAACTTGAGAGACAGAGTGAAG TTAATGAATGAGAATGCCAGCGTGGCAGATGTAGAC

AGTGCTGCACATCCCAGCTCAGAAACACCCTCTGCGACCAACTACTTCCTTCAGTACATCAGTTCCAG CGCAGACAACGCGACCCACAGTGCTGACAAC

TCCACCAAGTTTGTGTTTGGCCAGAACATGAGTGAGCGCGTCTTG - UNI8302 - AGCCCCCCAAAGCTGAATGAAGCCAATTCAGACACCAGCAGG

GAGACTACACATGCCCAGTCAGGTTCTGAGTCGTCATCCCAGGAGGCCGCCCCCAAGAAAG - UNI15151 - AGTCCCTGGCAGAGTCAGCCGCTGC

CTATACAAAGGCTACAGCGTGGACGTGTTTGCTGGAGAAGGTGGAGGTCATCACGGGGGAGGAGGCAGAGAGCAATGTGCTGCAG - UNI4943 - AT

CCAGTGTAAGCTGTTTGTGTTCGATAAGACCTCACAGTCATGGGTGGAGCGTGGCCGGGGACTTCTCAGGCTCAATGACATGGCGTCAACCGACGATGGC

ACATTACAGTCCCGGCTAG - UNI17634 - TGATGCGGACCCAGGGCAGCCTGCGGCTCATCCTGAACACGAAGCTGTGGGCACAGATGCAGATGGA

TAAGGCCAGTGAAAAGAGCATCCGCATCACAGCCACCGACGCTGAGGACCAGGGTGTCAAGGTTTTCCTGATCTCG - UNI16363 - GCCAGCTCCA

AAGACACAGGCCAACTGTATGCTGCACTGCACCACCGCATCCTGGCTCTGCGTAGCCGGGCTGAACAGGAACAGGAGGCCAAGGCGCCCCCACCTGAGCC

AGGAGCCACCCGGGCCACCGAGGAGGAAGACAGTGATGAGGATGCTGTTCTGGCTCCCTCCGGTGTCACGGGGGCTG - UNI15249 - GCACAGGTG

ATGAAGGAGATGGCCAGGCTCCTGGGAGCACATAGCGGCGGAGCCACTGCACCAGGCTGCTGCTTTGTTGTCTGTCTGCTGCCCGTCCCTCCCTGCAGGC

CGCATCATGGTGGTGTCTATTGCCGGGGTGGCCACAGGCTGGATCCGAGTGTCCCCTCTGCAGCAGACGGGGACGCCAGGATGCGGCTTGGGACTCAGAC

CTCATCATATTGATGAGTAGAAAGAACGTTCCCCCGCCCTCCTCCGATCGAAATGGCACATTGACACTTGTCACAGCTTCGTGGTGACCGTCCATCCCTG

GGCAGCAACAAAGAGAACTCCAGGCTCAGCATTCTGTTGAGTAACTTGCTACCTGCTCGGCTTTCCACTCTGCCAGGTCCACATGGCAGGTGCCTCTCCT

TCATTTCTGGTGGCTTGGCTCTTGAGGTCACAGATGAAGCTACACGTGGGCTGAGCTGACTTGATGCTCCTATGGGTGGTGCCCGGCCCCCACGGGGGTT

CACTAGGTTTGGGCCTGAGAACACCTGTCTGGACAAAGGTGATGAAACCAAGAGAGCTCCTGCCTTCTTGCCTGCCTACGTGAACCACCTGGGTCTCCCT

TAGCAGGTACCCAGCCCTGAGGTGACTGACCACCTAGGGCCCCTGAGAGGCAAAGGGAACCTGCAAAGGGCCTGTCCCCGGGCAGAAGATGAAGCCCCTA

CCCGTGGACTGTGTGGTTCCATCTCTGGCCAGGCCACTTCCAGCCAGCAAGGACACCAGAGGCTGCCTTAGCAGATGGGTCACACTGCTTCCAGCCTTAG

CCAGCCAGTGACAAGTGAATCCAGACGTCACCCATGTGTTTTGGAACATTTATGTAAGATTGAAATGTATTTGAGAACTGCATTAAAACTTTTAACT
Translation
MADLANEE - UNI1042 - - UNI6726 - EKPAVAPSVFVFQKDKGQK - UNI1042 - - UNI29360 - RSAGSSSPEAGED DSDHEDGN

YCPPVKRERTSSLTHSE - UNI12719 - EEKSSGFRLKPPTLIHGQAPSAG GLPSQKPREQQRGVLRPAVLQAPQPKVLSQTV VPSSGTNGVSMP

ADCTGPATSVSPENLTQRSPSESAEETHTLE EKVPQKTPHGTSEEGHCEEEQAAPQAFVFGQNLRDRVK LMNENASVADVDSAAHPSSETPSATNYFL

QYISSS SADNATHSADNSTKFVFGQNMSERVL - UNI8302 - SPPKLNEANSDTSRETTHAQSGSESSSQEAAPKKE - UNI15151 - ESLAE

SAAAYTKATAWTCLLEKVEVITGEEAESNVLQ - UNI4943 - IQCKLFVFDKTSQSWVERGRGLLRLNDMASTDDGTLQSRLV - UNI17634 - 

VMRTQGSLRLILNTKLWAQMQMDKASEKSIRITATDAEDQGVKVFLIS - UNI16363 - ASSKDTGQLYAALHHRILALRSRAEQEQEAKAPPPEPG

ATRATEEEDSDEDAVLAPSGVTGAG - UNI15249 - GTGDEGDGQAPGST

For any suggestions or comments, please send an email to unitrap@crg.es