Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002455 (Prpf6)
Chromosomal location
Chr 2: 181336073 - 181390365 (+)
Description
PRP6 pre-mRNA splicing factor 6 homolog (yeast) Gene [Source:MGI Symbol;Acc:MGI:1922946]
RefSeq_dna
NM_133701 
RefSeq_peptide
NP_598462.1 
UniGene
Mm.292001 
MGI
MGI:1922946 
Uniprot/SWISSPROT
Q91YR7 
Uniprot/SPTREMBL
Q3ULJ7 Q542P0 
Human Ortholog
ENSG00000101161 (PRPF6)
Omim not available
UniTrap UNI542
Vector Insertion
Chr 2: 181336237 - 181342824
Public Clones BC0445 (sanger) CMHD-GT_272E1-3 (cmhd) CMHD-GT_252C10-3 (cmhd) IST11853D8 (tigm)
Private Clones OST456567 (lexicon) OST417967 (lexicon) OST351731 (lexicon) OST237867 (lexicon)
OST120910 (lexicon) OST88784 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4503
Vector Insertion
Chr 2: 181342994 - 181350681
Public Clones AC0051 (sanger) RRM204 (baygenomics) CMHD-GT_280G8-3 (cmhd)
Private Clones OST106818 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21902
Vector Insertion
Chr 2: 181357023 - 181366139
Public Clones not available
Private Clones OST314421 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14308
Vector Insertion
Chr 2: 181366235 - 181366635
Public Clones FHCRC-GT-S20-2B1 (fhcrc)
Private Clones OST54077 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1950
Vector Insertion
Chr 2: 181370857 - 181371597
Public Clones CC0343 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16500
Vector Insertion
Chr 2: 181380298 - 181381993
Public Clones not available
Private Clones OST459672 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33753
Vector Insertion
Chr 2: 181385883 - 181387138
Public Clones IST13439H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000002529
Sequence
GCATCTCTTACTGCTGCGACACCCGGAGGACTCTGAGTCTTCTGTCGTATACTTGCTCCCCTGCTTTTCTGTGTTTCGGTCAATAACACCGCCATGAACA

AGAAGAAGAAGCCGTTCCTGGGCATGCCTGCGCCGCTGGGCTACGTACCCGGGCTGGGCAGGGG - UNI542 - TGCCACTGGCTTCACCACCCGATC

AGACATCGGGCCTGCTCGGGATGCAAATGATCCTGTGGATGATCGCCATGCCCCACCAGGGAAGAGAACTGTGGGGGACCAGATGAAGAAAAATCAGGCG

GCTGATGATGATGATGAAGATCTGAATGATACCAACTACGATGAG - UNI4503 - TTTAATGGCTATGCTGGGAGCCTCTTCTCAAGTGGGCCCTAT

GAAAAAGATGATGAGGAAGCAGATGCTATTTATGCAGCTCTGGATAAAAGGATGGATGAGAGAAGAAAAGAGAGAAG AGAGCAAAGGGAGAAAGAAGAG

ATTGAGAAATACCGAATGGAACGTCCCAAAATCCAGCAGCAATTTTCAGACCTTAAG AGGAAGCTGGCAGAAGTCACAGAAGAAGAGTGGCTGAGCATC

CCAGAAGTTGGCGATGCCAGAAACAAACGTCAACGGAACCCACGTTATGAGAAGCTGACTCCTGTTCCTGATAGTTTCTTTGCCAAACATTTACAGACTG

GAGAGAACCATACTTCTGTGGATCCCCGACAGACT CAATTTGGAGGTCTGAACACACCCTACCCGGGAGGCCTGAACACTCCATACCCAGGTGGAATGA

CACCTGGATTGATGACACCTGGTACAGGGGAGCTGGACATGAGGAAGATTGGCCAGGCAAGGAATACCCTGATGGACATGAGGCTTAGCCAG - UNI21

902 - GTATCTGACTCAGTGAGTGGGCAGACTGTTGTGGACCCCAAAGGCTACCTGACAGATCTAAATTCCATGATCCCAACCCATGGCGGGGACATAA

A - UNI14308 - TGACATCAAGAAAGCACGACTACTTCTCAAATCTGTTCGAGAAACAAACCCTCATCACCCACCAGCTTGGATTGCATCAGCTCGC

CTGGAAGAAGTCACTGGAAAGTTACAAGTAGCTCGAAACCTTATTATGAAAGGGACAGAGATGTGCCCCAAG AGTGAAGATGTCTGGCTAGAAGCAGCT

AGGTTACAGCCTGGGGACACAGCCAAGGCTGTGGTGGCACAAGCTGTCCGTCATCTCCCGCAGTCTGTTAGGATTTACATCAGAGCAGCAGAGCTAGAAA

CAGACATTCGAGCAAAGAAGCGTGTTCTTCGGAAAG CACTTGAGCATGTTCCAAACTCTGTTCGATTGTGGAAAGCAGCTGTTGAGCTTGAAGAGCCTG

AAGATGCTAGAATCATGCTGAGCCGAGCAGTAGAGTGCTGTCCCACCAGTGTAGAG - UNI1950 - CTATGGCTTGCTTTGGCAAGACTAGAAACTT

ATGAAAATGCTCGCAAGGTCTTAAATAAAGCACGTGAGAACATTCCTACAGATCGGCACATCTGGATCACAGCTGCCAAACTGGAGGAGGCCAATGGGAA

CACTCAGATGGTGGAAAAGATCATTGACCGAGCCATCACCTCCCTACGGGCCAATGGTGTAGAGATCAACCGCGAACAGTGGATCCAG GATGCTGAGGA

GTGTGACAGGGCAGGGAGTGTGGCCACGTGCCAGGCTGTCATGCGTGCTGTAATCGGTATTGGGATTGAGGAGGAAGATCGCAAACACACCTGGATGGAA

GACGCTGACAGT TGTGTGGCCCACAATGCCCTGGAGTGTGCACGAGCCATATATGCCTATGCCCTACAAGTCTTCCCCAGCAAGAAAAGTGTGTGGTTA

CGAGCTGCCTACTTTGAGAAGAATCATGGTACCAG - UNI16500 - GGAGTCTCTGGAAGCACTCTTGCAGAGGGCTGTAGCCCACTGCCCCAAGGC

AGAGGTGCTATGGCTCATGGGTGCCAAGTCAAAGTGGCTGGCAGGGGATGTACCTGCAGCAAGGAGCATCCTGGCCCTGGCCTTTCAG GCCAACCCCAA

CAGCGAAGAGATCTGGTTGGCGGCTGTGAAGCTGGAGTCAGAGAACAATGAATACGAGCGAGCCCGGAGGCTACTGGCCAAGGCTCGGAGCAGCGCACCC

ACTGCCCGT GTATTCATGAAGTCTGTGAAGCTGGAGTGGGTTCTGGGGAACATCTCTGCGGCGCAGGAGCTGTGTGAGGAGGCTCTGAGGCACTATGAA

GATTTCCCCAAGCTGTGGATGATGAAGGGGCAGATTGAGGAGCAGGGAGAACTGATGGAGAAGGCCCGGGAGGCCTACAACCAGGGG CTGAAGAAATGT

CCTCATTCCACACCGCTTTGGCTCTTGCTTTCCCGACTAGAGGAAAAGATTGGGCAGCTGACACGTGCTCGGGCCATTTTAGAGAAATCTCGTCTGAAAA

ACCCAAAGAACCCTGGGCTATG GTTGGAGTCAGTGCGGCTGGAGTACCGGGCAGGGCTGAAGAACATTGCCAATACCCTCATGGCCAAGGCGCTGCAGG

AGTGCCCTAACTCTG - UNI33753 - GTATCCTGTGGTCTGAAGCTGTCTTCCTTGAGGCAAGGCCCCAGAGAAAGACCAAGAGTGTGGATGCCCTG

AAGAAGTGTGAACATGACCCCCATGTGCTTTTAGCTGTGGCTAA GTTGTTCTGGAGTGAAAGAAAGATCACCAAGGCTCGGGAGTGGTTCCATCGCACT

GTGAAGATTGACTCAGATCTGGGGGATGCCTGGGCCTTCTTCTACAAATTTGAACTGCAGCATGGAACTGAG GAGCAACAGGAGGAGGTGAGGAAACGC

TGTGAGAATGCAGAGCCCCGACATGGAGAGCTGTGGTGTGCTGTGTCCAAGGATATCACCAACTGGCAGAGGAAGATTGGGGAAATCCTAGTCCTGGTGG

CCGCCCGCATCAAAAATACCTTCTGATAGGAGGGGTGACAATAGGAGCAACACATGGACAATGGGCACAAACCCTACACTGTCTTTTACTCATTAAAGGT

TTTTATAGAGTT
Translation
MNKKKKPFLGMPAPLGYVPGLGRG - UNI542 - GATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDE - UNI4

503 - FNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERR REQREKEEIEKYRMERPKIQQQFSDLK RKLAEVTEEEWLSIPEVGDARNKRQ

RNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQT QFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQ - UNI21902 -

 VSDSVSGQTVVDPKGYLTDLNSMIPTHGGDIN - UNI14308 - NDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPK

 SEDVWLEAARLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKA ALEHVPNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVE - 

UNI1950 - LWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQ DAEECDRAGSVATCQA

VMRAVIGIGIEEEDRKHTWMEDADS CVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTR - UNI16500 - RESLEALLQRAVAHCPKAE

VLWLMGAKSKWLAGDVPAARSILALAFQ ANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTAR VFMKSVKLEWVLGNISAAQELCEEALRHYE

DFPKLWMMKGQIEEQGELMEKAREAYNQG LKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLW WLESVRLEYRAGLKNIANTLMAKA

LQECPNSG - UNI33753 - GILWSEAVFLEARPQRKTKSVDALKKCEHDPHVLLAVAK KLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFEL

QHGTE EQQEEVRKRCENAEPRHGELWCAVSKDITNWQRKIGEILVLVAARIKNTF

For any suggestions or comments, please send an email to unitrap@crg.es