Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002496 (Tsc2)
Chromosomal location
Chr 17: 24732882 - 24769574 (-)
Description
tuberous sclerosis 2 Gene [Source:MGI Symbol;Acc:MGI:102548]
RefSeq_dna
NM_001039363 
RefSeq_peptide
NP_001034452.1 NP_035777.2 
MGI
MGI:102548 
Uniprot/SWISSPROT
Q61037 
Uniprot/SPTREMBL
Q3TBX9 Q3TCQ7 Q3TP98 Q3UG84 Q3UI96 Q7TT21 Q3TQ10 Q925J1 Q3UG88 Q3UGI8 Q3UHB2 
Human Ortholog
ENSG00000103197 (TSC2)
Omim 191100 - TUBEROUS SCLEROSIS  606690 - LYMPHANGIOLEIOMYOMATOSIS  
UniTrap UNI15458
Vector Insertion
Chr 17: 24767857 - 24769057
Public Clones PST8217-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097373
Sequence
GTACGGGTTGCGCTTCCGGCAGCTGCCCTGGGCCGGGGGTGTGCGCCCTTCCCTGGGTGCAGGAGGACCTGCGCGCGAAAGGCGCGCGCGGG - UNI15

458 - AGCAGTTCTCTAGTACTGCCCTGCCCACCATGGCCAAACCAACAAGCAAAGATTCCGGCTTGAAGGAGAAGTTCAAGATACTGTTGGGATTGGG

AACATCGAGGCCAAATCCCAGGTGTGCAGAAGGCAAACAGACTGAGTTTATCATCACATCGGAAATCTTGAGA - UNI15458 - GAACTGAGTGGTG

AATGCGGCCTCAACAATCGCATCCGAATGATAGGGCAGATCTGTGATGTGGCAAAAACTAAGAAGCTTGAGGAG - UNI15458 - CATGCAGTGGAG

GCACTTTGGAAGGCTGTCTCAGACTTGCTACAGCCAGAGCGGCCACCAGAGGCCCGGCATGCAGTTCTCACCTTATTGAAGGCCATTGTACAGGGACAG 

GGTGATCGTTTGGGAGTTCTCAGAGCCCTCTTCTTCAAAGTGATCAAGGACTACCCCTCCAATGAAGACCTCCATGAAAGGCTAGAAGTTTTTAAGGCCC

TCACAGACAATGGGAGGCACATTACCTATTTGGAAGAAGAACTGG CAGAGTTTGTCCTGCAGTGGATGGATGTTGGCTTGTCCTCAGAATTCCTTCTGG

TACTTGTCAACCTGGTCAAGTTCAACAGCTGTTACCTTGACGAATACATTGCATCAATGGTTCA CATGATTTGTCTGCTATGCATCCGGACAGTGTCCT

CTGTGGACATTGAG GTGTCCTTGCAAGTGCTGGATGCTGTGGTCTGCTACAACTGCTTACCAGCCGAGAGCCTGCCTCTGTTCATTATCACCCTGTGCC

GCACCATCAATGTCAAGGAGCTGTGTGAGCCTTGCTGGAAG TTGATGCGTAACCTTCTGGGCACCCACCTGGGCCACAGCGCCATCTACAACATGTGCC

GCATCATGGAGGACAG ATCCTACATGGAAGATGCCCCACTGCTGAGAGGAGCTGTGTTCTTTGTAGGGATGGCACTCTGGGGAGCTCACCGGCTCTACT

CTCTCAAGAACTCCCCCACATCTGTGCTGCCGTCTTTTTATGAG GCTATGACCTGTCCCAATGAGGTGGTGTCATATGAGATTGTTCTGTCCATAACAA

GACTCATCAAGAAGTATAGGAAGGAGCTCCAGGCTGTGACATGGGATATTCTGCTGGACATCATTGAACGACTACTTCAGCAACTCCAG AACCTGGACA

GCCCGGAACTCAAGACCATCGTCCATGACCTGCTGACCACTGTGGAGGAGCTATGTGACCAGAACGAGTTCCATGGCTCGCAGGAAAGATACTATGAACT

GGTGGAGAGCTATGCAGACCAGAGACCT GAATCCTCTCTCTTAAACTTGATATCCTACAGAGCCCAGTCCATCCACCCTGCCAAGGATGGCTGGATCCA

GAACTTGCAGTTGTTGATGGAGAGGTTCTTCAG GAATGAGTGCCGCAGCGCCGTGCGCATCAAGGTGTTGGATGTTCTGTCCTTCGTGCTGCTGATCAA

CAGGCAGTTCTATGAG GAGGAGCTGATTAACTCGGTGGTCATCTCGCAGCTCTCCCACATTCCCGAGGATAAGGACCATCAGGTCCGAAAGCTGGCTAC

TCAGCTGCTGGTGGACCTGGCAGAGGGGTGCCACACCCACCACTTCAACAGTCTGCTGGACATCATTGAAAAG GTGATGGCGCGCTCACTCTCTCCACC

CCCGGAGCTGGAAGAAAGGGACCTGGCCATGCACTCGGCCTCCCTGGAGGACGTGAAGACCGCGGTCCTGGGGCTCCTGGTCATCCTTCAG ACCAAGCT

CTACACCTTGCCTGCCAGCCACGCCACTCGAGTGTATGAGAGCCTCATTAGTCACATCCAGCTCCATTACAAGCACGGCTACTCCCTGCCCATTGCTAGC

AGCATCCGACTACAG GCCTTTGACTTCCTGCTGCTACTGCGGGCTGACTCGCTGCATCGACTGGGCCTGCCCAACAAGGATGGGGTCGTGAGATTCAGC

CCTTACTGCCTCTGTGACTGCAT GGAACTGGATAGAGCCTCAGAGAAGAAAGCCAGTGGGCCCCTTTCACCTCCAACTGGGCCCCCTAGCCCTGTGCCT

ATGGGCCCTGCTGTGCGGCTCGGCTACCTACCCTACTCCCTGCTCTTCCGTGTCCTGTTGCAGTGTTTGAAGCAG GAGAGCGACTGGAAGGTGCTGAAG

CTGGTGCTCAGCAGGCTGCCGGAGTCACTGCGCTACAAAGTCCTCATCTTCACCTCCCCCTGCAGTGTCGACCAGCTGTCTTCTGCCCTCTGCTCCATG 

CTTTCAGCTCCAAAGACCCTTGAGCGGCTCCGAGGTACCCCAGAAGGCTTCTCGAGAACTGACCTGCACTTGGCTGTGGTTCCCGTGCTAACAGCATTAA

TATCTTATCACAACTATTTGGACAAGACCAGACAG CGTGAGATGGTGTACTGCCTGGAACAAGGCCTTATCTACCGCTGCGCCAGCCAGTGCGTGGTAG

CCTTGGCCATCTGCAGTGTGGAGATGCCCGACATCATCATCAAGGCGCTTCCTGTCCTGGTGGTGAAGCTCACACACATTTCTGCCACAGCCAGCATGGC

CATCCCGCTCCTGGAGTTCCTGTCTA CTTTGGCCAGGCTGCCCCACCTCTACAGGAACTTTGCTGCAGAGCAGTATGCCAGCGTGTTTGCCATCTCCTT

GCCATACACCAACCCCTCCAA GTTCAACCAGTACATTGTGTGTCTGGCTCACCACGTCATAGCCATGTGGTTCATCAGGTGCCGACTGCCCTTTCGGAA

GGATTTCGTCCCTTATATCACTAAG GGTTTGCGTTCCAATGTCCTCCTGTCTTTTGATGATACCCCTGAGAAGGACAGTTTCAGAGCACGGAGCACCAG

TCTTAATGAGAGACCCAAAAG CAGAATACAGACATCCCTTACGAGCGCCAGCCTGGGGTCTGCGGATGAGAACTCTATGGCCCAGGCTGATGACAACTT

GAAGAATCTCCACTTGGAGCTCACAGAAACATGTCTGGACATGATGGCCCGATATGTGTTCTCCAATTTCACTGCAGTCCCCAAGAG GTCCCCTGTGGG

AGAGTTCCTCCTGGCAGGGGGTAGGACCAAAACCTGGCTGGTTGGAAACAAGCTTGTCACTGTGACAACAAGTGTGGGAACTGGTACACGGTCGCTGCTG

GGCCTGGACTCTGGGGACCTGCAGGGTGGCTCGGATTCAAG CTCTGATCCTAGCACACATGTGAGGCAGACAAAGGAAGCACCGGCCAAACTGGAGTCC

CAGGCTGGGCAGCAGGTGTCCCGTGGGGCCCGGGACCGGGTCCGCTCCATGTCAG GGGGCCATGGCCTTCGAGTTGGTGTCCTGGATACTTCAGCTCCC

TATTCCCCAGGTGGCTCTGCTTCTCTGGGACCACAGACGGCGGTGGCAGCGAAGCCCGAGAAGCCCCCTGCAGGAGCCCAGCTTCCAACAGCAGAGAAGA

CGAATCTGGCAGCCTATGTGCCTTTGTTAACCCAGGGCTGGGCAGAAATCTTAGTCCGCAGACCCACAG GAAACACCAGCTGGCTGATGAGCTTGGAGA

ACCCGCTCAGCCCCTTCTCCTCAGACATCAACAACATGCCCCTGCAAGAGCTGTCCAATGCCCTTATGGCTGCTGAACGTTTCAAGGAGCACCGGGACAC

GGCCCTGTACAAGTCATTGTCAGTGCCAGCGGCTGGCACCGCCAAGCCTCCTACTCTCCCACGCTCTAATACAG ACTCAGCCATGGTCCTTGAGGAGGG

AAGTCCAGGAGAGACTCAGGTGCCAGTGGAGCCCCCCGAATTGGAGGATTTCGAGGCGGCGTTAGGTACAGACAGGCACTGCCAGCGGCCTGACACCTAC

AGCCGG TCATCCTCAGCATCTAGCCAGGAAGAAAAGTCCCATTTGGAGGAGCTTGCTGCAGGGGGTATCCCCATTGAGCGGGCCATCTCCTCTGAGGGG

GCTCGGCCTGCCGTGGACCTCTCCTTCCAACCCTCACAGCCTTTGAGCAAGTCTAGCTCTTCTCCGGAGTTGCAGACCTTACAGGACATCCTTGGAGACC

TAGGGGACAAGATTGATATTGGACGGCTGAGTCCTGAGGCTAAGGTCCGGTCCCAGTCAGGGATCCTGGATGGGGAAGCAGCTACCTGGTCAGCTACGGG

TGAAGAGAGCCGTATCACAGTCCCACCTGAAGGTCCTCTGCCTTCCAGTTCTCCCCGCTCCCCCAGTGGCCTCCGGCCCCGAGGCTATACCATCTCTGAT

TCCGCTCCATCACGAAGGGGAAAGAGGGTAGAAAGGGATAACTTCAAGAGCAGAGCTGCGGCCTCCAGTGCTGAGAAGGTGCCAGGCATCAACCCTAG C

TTTGTGTTCCTACAGCTCTACCATTCGCCCTTTTTTGGTGATGAGTCCAATAAGCCCATCCTATTGCCCAATGAG TCCTTTGAACGGTCAGTACAGCTG

CTTGACCAGATTCCATCCTATGACACTCACAAGATTGCTGTCCTGTATGTGGGAGAAGGCCAG AGCAGCAGTGAGCTGGCCATCCTGTCAAATGAGCAT

GGCTCTTACAGGTACACGGAGTTTCTGACAGGCCTGGGTCGGCTTATTGAGCTCAAGGACTGCCAACCAGACAAGGTGTACTTAGGTGGACTGGATGTAT

GTGGCGAGGATGGACAGTTCACCTACTGCTGGCATGATGACATCATGCAAG CTGTTTTCCACATTGCCACCCTGATGCCCACCAAGGATGTGGACAAGC

ACCGCTGTGACAAGAAACGGCACCTGGGCAATGACTTTGTTTCTATCATCTACAATGATTCTGGTGAGGACTTCAAACTGGGCACCATTAAG GGCCAGT

TCAACTTTGTCCATGTGATCATCACACCGCTGGACTACAAGTGCAACCTATTGACCCTGCAGTGCAGGAAAG ACATGGAAGGCCTCGTGGACACCAGTG

TGGCCAAGATTGTGTCTGACCGCAACCTGTCCTTTGTGGCCCGACAGATGGCCCTGCATGCAAAT ATGGCCTCACAGGTACACCACAGCCGATCCAACC

CCACTGACATCTATCCCTCCAAGTGGATCGCAAGACTCCGCCACATTAAGCGTCTCCGCCAGAGG ATCCGTGAAGAGGTGCACTATTCCAACCCAAGCT

TGCCTCTGATGCACCCTCCAGCCCACACCAAAGCCCCAGCTCAAGCCCCTGAGGCTACACCCACCTATGAAACAGGCCAGCGGAAGCGCCTCATTTCCTC

CGTGGATGACTTCACAGAGTTTGTGTGAGGCCAGCAGATCCATGACTAGAGTCCTGTGGCCAGCCATGTAGCTATCCTGACTGTACTCCTACATGAAATA

AACTGCACACGCACATCTGGCCCGTGGAGTTCAGAGAGCAGCACAGACAGCAGTCAGACAGCTTCTTTATTTGACTTTGTCTTGTCTGTTTGGGGTTGGG

GCAGAATCCAGGCTAGAGCTGCAGATGAGCCCACAGAAGCAGGCAGGTGCCATCACATACATTCTCTTTCCCCCACCCGCCATGGGGGCAAGCCCCATTG

GTGGGCTTGTCCAGTAACTTCTTGGCATCTTTCATCCCACAGTAGTCCTGCCCTTGCTCAGATCTGAAACCAGCAGATCTGCGTGCTGCCTGGCCCCAGA

CAAGGGAGGAAAACAAGGCCACGGTGGCCCCAATTGCTGTCCAGCACCTGCCCGAGGCCAGACTCGGATCCAGTAATAGCTGCAGCTTCCCCTGTACCCC

TGCCCTGGGTAACAATGGACCCATTTTCAGCCCAAGTAGAAAATACTGACATACAAAAATATATACATTTTAACCCCATATAAATTATTGATGGTGGACA

TAGAAAGCAGATGGTAGCTAGAGGGCAAGTATGCTGCAGAAACAAGAGAGGTAATAACTTAGGGGACGGATAAAGGAGAAGTGTAGCTTAGCCCTC
Translation
 - UNI15458 - MAKPTSKDSGLKEKFKILLGLGTSRPNPRCAEGKQTEFIITSEILR - UNI15458 - ELSGECGLNNRIRMIGQICDVAKTKK

LEE - UNI15458 - HAVEALWKAVSDLLQPERPPEARHAVLTLLKAIVQGQ GDRLGVLRALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLE

EELA AEFVLQWMDVGLSSEFLLVLVNLVKFNSCYLDEYIASMVH HMICLLCIRTVSSVDIE VSLQVLDAVVCYNCLPAESLPLFIITLCRTINVKEL

CEPCWK LMRNLLGTHLGHSAIYNMCRIMEDR RSYMEDAPLLRGAVFFVGMALWGAHRLYSLKNSPTSVLPSFYE AMTCPNEVVSYEIVLSITRLIKK

YRKELQAVTWDILLDIIERLLQQLQ NLDSPELKTIVHDLLTTVEELCDQNEFHGSQERYYELVESYADQRP ESSLLNLISYRAQSIHPAKDGWIQNLQ

LLMERFFR RNECRSAVRIKVLDVLSFVLLINRQFYE EELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEK VMARSLSPP

PELEERDLAMHSASLEDVKTAVLGLLVILQ TKLYTLPASHATRVYESLISHIQLHYKHGYSLPIASSIRLQ AFDFLLLLRADSLHRLGLPNKDGVVRF

SPYCLCDCM MELDRASEKKASGPLSPPTGPPSPVPMGPAVRLGYLPYSLLFRVLLQCLKQ ESDWKVLKLVLSRLPESLRYKVLIFTSPCSVDQLSSAL

CSM LSAPKTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYLDKTRQ REMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISA

TASMAIPLLEFLST TLARLPHLYRNFAAEQYASVFAISLPYTNPSK KFNQYIVCLAHHVIAMWFIRCRLPFRKDFVPYITK GLRSNVLLSFDDTPEK

DSFRARSTSLNERPKS SRIQTSLTSASLGSADENSMAQADDNLKNLHLELTETCLDMMARYVFSNFTAVPKR RSPVGEFLLAGGRTKTWLVGNKLVTV

TTSVGTGTRSLLGLDSGDLQGGSDSS SSDPSTHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSG GGHGLRVGVLDTSAPYSPGGSASLGPQTAVAAK

PEKPPAGAQLPTAEKTNLAAYVPLLTQGWAEILVRRPTG GNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSVPAAGTAKP

PTLPRSNTD DSAMVLEEGSPGETQVPVEPPELEDFEAALGTDRHCQRPDTYSR SSSASSQEEKSHLEELAAGGIPIERAISSEGARPAVDLSFQPSQP

LSKSSSSPELQTLQDILGDLGDKIDIGRLSPEAKVRSQSGILDGEAATWSATGEESRITVPPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVERDN

FKSRAAASSAEKVPGINPS SFVFLQLYHSPFFGDESNKPILLPNE SFERSVQLLDQIPSYDTHKIAVLYVGEGQ SSSELAILSNEHGSYRYTEFLTG

LGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQA AVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIIYNDSGEDFKLGTIK GQFNFVHVIIT

PLDYKCNLLTLQCRKD DMEGLVDTSVAKIVSDRNLSFVARQMALHAN MASQVHHSRSNPTDIYPSKWIARLRHIKRLRQR IREEVHYSNPSLPLMHP

PAHTKAPAQAPEATPTYETGQRKRLISSVDDFTEFV
Transcript ENSMUST00000115290
Sequence
GTACGGGTTGCGCTTCCGGCAGCTGCCCTGGGCCGGGGGTGTGCGCCCTTCCCTGGGTGCAGGAGGACCTGCGCGCGAAAGGCGCGCGCGGG - UNI15

458 - AGCAGTTCTCTAGTACTGCCCTGCCCACCATGGCCAAACCAACAAGCAAAGATTCCGGCTTGAAGGAGAAGTTCAAGATACTGTTGGGATTGGG

AACATCGAGGCCAAATCCCAGGTGTGCAGAAGGCAAACAGACTGAGTTTATCATCACATCGGAAATCTTGAGA - UNI15458 - GAACTGAGTGGTG

AATGCGGCCTCAACAATCGCATCCGAATGATAGGGCAGATCTGTGATGTGGCAAAAACTAAGAAGCTTGAGGAG - UNI15458 - CATGCAGTGGAG

GCACTTTGGAAGGCTGTCTCAGACTTGCTACAGCCAGAGCGGCCACCAGAGGCCCGGCATGCAGTTCTCACCTTATTGAAGGCCATTGTACAGGGACAG 

GGTGATCGTTTGGGAGTTCTCAGAGCCCTCTTCTTCAAAGTGATCAAGGACTACCCCTCCAATGAAGACCTCCATGAAAGGCTAGAAGTTTTTAAGGCCC

TCACAGACAATGGGAGGCACATTACCTATTTGGAAGAAGAACTGG CAGAGTTTGTCCTGCAGTGGATGGATGTTGGCTTGTCCTCAGAATTCCTTCTGG

TACTTGTCAACCTGGTCAAGTTCAACAGCTGTTACCTTGACGAATACATTGCATCAATGGTTCA CATGATTTGTCTGCTATGCATCCGGACAGTGTCCT

CTGTGGACATTGAG GTGTCCTTGCAAGTGCTGGATGCTGTGGTCTGCTACAACTGCTTACCAGCCGAGAGCCTGCCTCTGTTCATTATCACCCTGTGCC

GCACCATCAATGTCAAGGAGCTGTGTGAGCCTTGCTGGAAG TTGATGCGTAACCTTCTGGGCACCCACCTGGGCCACAGCGCCATCTACAACATGTGCC

GCATCATGGAGGACAG ATCCTACATGGAAGATGCCCCACTGCTGAGAGGAGCTGTGTTCTTTGTAGGGATGGCACTCTGGGGAGCTCACCGGCTCTACT

CTCTCAAGAACTCCCCCACATCTGTGCTGCCGTCTTTTTATGAG GCTATGACCTGTCCCAATGAGGTGGTGTCATATGAGATTGTTCTGTCCATAACAA

GACTCATCAAGAAGTATAGGAAGGAGCTCCAGGCTGTGACATGGGATATTCTGCTGGACATCATTGAACGACTACTTCAGCAACTCCAG AACCTGGACA

GCCCGGAACTCAAGACCATCGTCCATGACCTGCTGACCACTGTGGAGGAGCTATGTGACCAGAACGAGTTCCATGGCTCGCAGGAAAGATACTATGAACT

GGTGGAGAGCTATGCAGACCAGAGACCT GAATCCTCTCTCTTAAACTTGATATCCTACAGAGCCCAGTCCATCCACCCTGCCAAGGATGGCTGGATCCA

GAACTTGCAGTTGTTGATGGAGAGGTTCTTCAG GAATGAGTGCCGCAGCGCCGTGCGCATCAAGGTGTTGGATGTTCTGTCCTTCGTGCTGCTGATCAA

CAGGCAGTTCTATGAG GAGGAGCTGATTAACTCGGTGGTCATCTCGCAGCTCTCCCACATTCCCGAGGATAAGGACCATCAGGTCCGAAAGCTGGCTAC

TCAGCTGCTGGTGGACCTGGCAGAGGGGTGCCACACCCACCACTTCAACAGTCTGCTGGACATCATTGAAAAG GTGATGGCGCGCTCACTCTCTCCACC

CCCGGAGCTGGAAGAAAGGGACCTGGCCATGCACTCGGCCTCCCTGGAGGACGTGAAGACCGCGGTCCTGGGGCTCCTGGTCATCCTTCAG ACCAAGCT

CTACACCTTGCCTGCCAGCCACGCCACTCGAGTGTATGAGAGCCTCATTAGTCACATCCAGCTCCATTACAAGCACGGCTACTCCCTGCCCATTGCTAGC

AGCATCCGACTACAG GCCTTTGACTTCCTGCTGCTACTGCGGGCTGACTCGCTGCATCGACTGGGCCTGCCCAACAAGGATGGGGTCGTGAGATTCAGC

CCTTACTGCCTCTGTGACTGCAT GGAACTGGATAGAGCCTCAGAGAAGAAAGCCAGTGGGCCCCTTTCACCTCCAACTGGGCCCCCTAGCCCTGTGCCT

ATGGGCCCTGCTGTGCGGCTCGGCTACCTACCCTACTCCCTGCTCTTCCGTGTCCTGTTGCAGTGTTTGAAGCAG GAGAGCGACTGGAAGGTGCTGAAG

CTGGTGCTCAGCAGGCTGCCGGAGTCACTGCGCTACAAAGTCCTCATCTTCACCTCCCCCTGCAGTGTCGACCAGCTGTCTTCTGCCCTCTGCTCCATG 

CTTTCAGCTCCAAAGACCCTTGAGCGGCTCCGAGGTACCCCAGAAGGCTTCTCGAGAACTGACCTGCACTTGGCTGTGGTTCCCGTGCTAACAGCATTAA

TATCTTATCACAACTATTTGGACAAGACCAGACAG CGTGAGATGGTGTACTGCCTGGAACAAGGCCTTATCTACCGCTGCGCCAGCCAGTGCGTGGTAG

CCTTGGCCATCTGCAGTGTGGAGATGCCCGACATCATCATCAAGGCGCTTCCTGTCCTGGTGGTGAAGCTCACACACATTTCTGCCACAGCCAGCATGGC

CATCCCGCTCCTGGAGTTCCTGTCTA CTTTGGCCAGGCTGCCCCACCTCTACAGGAACTTTGCTGCAGAGCAGTATGCCAGCGTGTTTGCCATCTCCTT

GCCATACACCAACCCCTCCAA GTTCAACCAGTACATTGTGTGTCTGGCTCACCACGTCATAGCCATGTGGTTCATCAGGTGCCGACTGCCCTTTCGGAA

GGATTTCGTCCCTTATATCACTAAG GGTTTGCGTTCCAATGTCCTCCTGTCTTTTGATGATACCCCTGAGAAGGACAGTTTCAGAGCACGGAGCACCAG

TCTTAATGAGAGACCCAAAAG AATACAGACATCCCTTACGAGCGCCAGCCTGGGGTCTGCGGATGAGAACTCTATGGCCCAGGCTGATGACAACTTGAA

GAATCTCCACTTGGAGCTCACAGAAACATGTCTGGACATGATGGCCCGATATGTGTTCTCCAATTTCACTGCAGTCCCCAAGAG GTCCCCTGTGGGAGA

GTTCCTCCTGGCAGGGGGTAGGACCAAAACCTGGCTGGTTGGAAACAAGCTTGTCACTGTGACAACAAGTGTGGGAACTGGTACACGGTCGCTGCTGGGC

CTGGACTCTGGGGACCTGCAGGGTGGCTCGGATTCAAG CTCTGATCCTAGCACACATGTGAGGCAGACAAAGGAAGCACCGGCCAAACTGGAGTCCCAG

GCTGGGCAGCAGGTGTCCCGTGGGGCCCGGGACCGGGTCCGCTCCATGTCAG GGGGCCATGGCCTTCGAGTTGGTGTCCTGGATACTTCAGCTCCCTAT

TCCCCAGGTGGCTCTGCTTCTCTGGGACCACAGACGGCGGTGGCAGCGAAGCCCGAGAAGCCCCCTGCAGGAGCCCAGCTTCCAACAGCAGAGAAGACGA

ATCTGGCAGCCTATGTGCCTTTGTTAACCCAGGGCTGGGCAGAAATCTTAGTCCGCAGACCCACAG GAAACACCAGCTGGCTGATGAGCTTGGAGAACC

CGCTCAGCCCCTTCTCCTCAGACATCAACAACATGCCCCTGCAAGAGCTGTCCAATGCCCTTATGGCTGCTGAACGTTTCAAGGAGCAC GGACACGGCC

CTGTACAAGTCATTGTCAGTGCCAGCGGCTGG ACCGCCAAGCCTCCTACTCTCCCACGCTCTAATACAG TGGCTTCTTTCTCCTCCCTGTACCAGCCC

AGCTGCCAAGGACAGCTGCACAGGAGCGTTTCCTGGGCAG ACTCAGCCATGGTCCTTGAGGAGGGAAGTCCAGGAGAGACTCAGGTGCCAGTGGAGCCC

CCCGAATTGGAGGATTTCGAGGCGGCGTTAGGTACAGACAGGCACTGCCAGCGGCCTGACACCTACAGCCGG TCATCCTCAGCATCTAGCCAGGAAGAA

AAGTCCCATTTGGAGGAGCTTGCTGCAGGGGGTATCCCCATTGAGCGGGCCATCTCCTCTGAGGGGGCTCGGCCTGCCGTGGACCTCTCCTTCCAACCCT

CACAGCCTTTGAGCAAGTCTAGCTCTTCTCCGGAGTTGCAGACCTTACAGGACATCCTTGGAGACCTAGGGGACAAGATTGATATTGGACGGCTGAGTCC

TGAGGCTAAGGTCCGGTCCCAGTCAGGGATCCTGGATGGGGAAGCAGCTACCTGGTCAGCTACGGGTGAAGAGAGCCGTATCACAGTCCCACCTGAAGGT

CCTCTGCCTTCCAGTTCTCCCCGCTCCCCCAGTGGCCTCCGGCCCCGAGGCTATACCATCTCTGATTCCGCTCCATCACGAAGGGGAAAGAGGGTAGAAA

GGGATAACTTCAAGAGCAGAGCTGCGGCCTCCAGTGCTGAGAAGGTGCCAGGCATCAACCCTAG CTTTGTGTTCCTACAGCTCTACCATTCGCCCTTTT

TTGGTGATGAGTCCAATAAGCCCATCCTATTGCCCAATGAG TCCTTTGAACGGTCAGTACAGCTGCTTGACCAGATTCCATCCTATGACACTCACAAGA

TTGCTGTCCTGTATGTGGGAGAAGGCCAG AGCAGCAGTGAGCTGGCCATCCTGTCAAATGAGCATGGCTCTTACAGGTACACGGAGTTTCTGACAGGCC

TGGGTCGGCTTATTGAGCTCAAGGACTGCCAACCAGACAAGGTGTACTTAGGTGGACTGGATGTATGTGGCGAGGATGGACAGTTCACCTACTGCTGGCA

TGATGACATCATGCAAG CTGTTTTCCACATTGCCACCCTGATGCCCACCAAGGATGTGGACAAGCACCGCTGTGACAAGAAACGGCACCTGGGCAATGA

CTTTGTTTCTATCATCTACAATGATTCTGGTGAGGACTTCAAACTGGGCACCATTAAG CAGGGCCAGTTCAACTTTGTCCATGTGATCATCACACCGCT

GGACTACAAGTGCAACCTATTGACCCTGCAGTGCAGGAAAG ATGGCCCTGCATGCAAATGTGAGTGGTGGCGGCAGCCTGGGGAGATAGTCGTGTGGGC

GCTCCCTGTTGTGATGGAGCTCACTGTCACCATCCTGCTCTGTCACCTCCAGATGGCCTCACAGGTACACCACAGCCGATCCAACCCCACTGACATCTAT

CCCTCCAAGTGGATCGCAAGACTCCGCCACATTAAGCGTCTCCGCCAGAGG ATCCGTGAAGAGGTGCACTATTCCAACCCAAGCTTGCCTCTGATGCAC

CCTCCAGCCCACACCAAAGCCCCAGCTCAAGCCCCTGAGGCTACACCCACCTATGAAACAGGCCAGCGGAAGCGCCTCATTTCCTCCGTGGATGACTTCA

CAGAGTTTGTGTGAGGCCAGCAGATCCATGACTAGAGTCCTGTGGCCAGCCATGTAGCTATCCTGACTGTACTCCTACATGAAATAAACTGCACACGCAC

ATCTGGCCCGTGGAGTTCAGAGAGCAGCACAGACAGCAGTCAGACAGCTTCTTTATTTGACTTTGTCTTGTCTGTTTGGGGTTGGGGCAGAATCCAGGCT

AGAGCTGCAGATGAGCCCACAGAAGCAGGCAGGTGCCATCACATACATTCTCTTTCCCCCACCCGCCATGGGGGCAAGCCCCATTGGTGGGCTTGTCCAG

TAACTTCTTGGCATCTTTCATCCCACAGTAGTCCTGCCCTTGCTCAGATCTGAAACCAGCAGATCTGCGTGCTGCCTGGCCCCAGACAAGGGAGGAAAAC

AAGGCCACGGTGGCCCCAATTGCTGTCCAGCACCTGCCCGAGGCCAGACTCGGATCCAGTAATAGCTGCAGCTTCCCCTGTACCCCTGCCCTGGGTAACA

ATGGACCCATTTTCAGCCCAAGTAGAAAATACTGACATACAAAAATATATACATTTTAACCCCATATAAATTATTGATGGTGGACATAGAAAGCAGATGG

TAGCTAGAGGGCAAGTATGCTGCAGAAACAAGAGAGGTAATAACTTAGGGGACGGATAAAGGAGAAGTGTAGCTTAGCCCTC
Translation
 - UNI15458 - MAKPTSKDSGLKEKFKILLGLGTSRPNPRCAEGKQTEFIITSEILR - UNI15458 - ELSGECGLNNRIRMIGQICDVAKTKK

LEE - UNI15458 - HAVEALWKAVSDLLQPERPPEARHAVLTLLKAIVQGQ GDRLGVLRALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLE

EELA AEFVLQWMDVGLSSEFLLVLVNLVKFNSCYLDEYIASMVH HMICLLCIRTVSSVDIE VSLQVLDAVVCYNCLPAESLPLFIITLCRTINVKEL

CEPCWK LMRNLLGTHLGHSAIYNMCRIMEDR RSYMEDAPLLRGAVFFVGMALWGAHRLYSLKNSPTSVLPSFYE AMTCPNEVVSYEIVLSITRLIKK

YRKELQAVTWDILLDIIERLLQQLQ NLDSPELKTIVHDLLTTVEELCDQNEFHGSQERYYELVESYADQRP ESSLLNLISYRAQSIHPAKDGWIQNLQ

LLMERFFR RNECRSAVRIKVLDVLSFVLLINRQFYE EELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEK VMARSLSPP

PELEERDLAMHSASLEDVKTAVLGLLVILQ TKLYTLPASHATRVYESLISHIQLHYKHGYSLPIASSIRLQ AFDFLLLLRADSLHRLGLPNKDGVVRF

SPYCLCDCM MELDRASEKKASGPLSPPTGPPSPVPMGPAVRLGYLPYSLLFRVLLQCLKQ ESDWKVLKLVLSRLPESLRYKVLIFTSPCSVDQLSSAL

CSM LSAPKTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYLDKTRQ REMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISA

TASMAIPLLEFLST TLARLPHLYRNFAAEQYASVFAISLPYTNPSK KFNQYIVCLAHHVIAMWFIRCRLPFRKDFVPYITK GLRSNVLLSFDDTPEK

DSFRARSTSLNERPKR RIQTSLTSASLGSADENSMAQADDNLKNLHLELTETCLDMMARYVFSNFTAVPKR RSPVGEFLLAGGRTKTWLVGNKLVTVT

TSVGTGTRSLLGLDSGDLQGGSDSS SSDPSTHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSG GGHGLRVGVLDTSAPYSPGGSASLGPQTAVAAKP

EKPPAGAQLPTAEKTNLAAYVPLLTQGWAEILVRRPTG GNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEH GHGPVQVIVSASGW TAKP

PTLPRSNTV VASFSSLYQPSCQGQLHRSVSWAD DSAMVLEEGSPGETQVPVEPPELEDFEAALGTDRHCQRPDTYSR SSSASSQEEKSHLEELAAGG

IPIERAISSEGARPAVDLSFQPSQPLSKSSSSPELQTLQDILGDLGDKIDIGRLSPEAKVRSQSGILDGEAATWSATGEESRITVPPEGPLPSSSPRSPS

GLRPRGYTISDSAPSRRGKRVERDNFKSRAAASSAEKVPGINPS SFVFLQLYHSPFFGDESNKPILLPNE SFERSVQLLDQIPSYDTHKIAVLYVGEG

Q SSSELAILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQA AVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIIY

NDSGEDFKLGTIK QGQFNFVHVIITPLDYKCNLLTLQCRKD DGPACKCEWWRQPGEIVVWALPVVMELTVTILLCHLQMASQVHHSRSNPTDIYPSKW

IARLRHIKRLRQR IREEVHYSNPSLPLMHPPAHTKAPAQAPEATPTYETGQRKRLISSVDDFTEFV
Transcript ENSMUST00000115291
Sequence
GTACGGGTTGCGCTTCCGGCAGCTGCCCTGGGCCGGGGGTGTGCGCCCTTCCCTGGGTGCAGGAGGACCTGCGCGCGAAAGGCGCGCGCGGG - UNI15

458 - AGCAGTTCTCTAGTACTGCCCTGCCCACCATGGCCAAACCAACAAGCAAAGATTCCGGCTTGAAGGAGAAGTTCAAGATACTGTTGGGATTGGG

AACATCGAGGCCAAATCCCAGGTGTGCAGAAGGCAAACAGACTGAGTTTATCATCACATCGGAAATCTTGAGA - UNI15458 - GAACTGAGTGGTG

AATGCGGCCTCAACAATCGCATCCGAATGATAGGGCAGATCTGTGATGTGGCAAAAACTAAGAAGCTTGAGGAG - UNI15458 - CATGCAGTGGAG

GCACTTTGGAAGGCTGTCTCAGACTTGCTACAGCCAGAGCGGCCACCAGAGGCCCGGCATGCAGTTCTCACCTTATTGAAGGCCATTGTACAGGGACAG 

GGTGATCGTTTGGGAGTTCTCAGAGCCCTCTTCTTCAAAGTGATCAAGGACTACCCCTCCAATGAAGACCTCCATGAAAGGCTAGAAGTTTTTAAGGCCC

TCACAGACAATGGGAGGCACATTACCTATTTGGAAGAAGAACTGG CAGAGTTTGTCCTGCAGTGGATGGATGTTGGCTTGTCCTCAGAATTCCTTCTGG

TACTTGTCAACCTGGTCAAGTTCAACAGCTGTTACCTTGACGAATACATTGCATCAATGGTTCA CATGATTTGTCTGCTATGCATCCGGACAGTGTCCT

CTGTGGACATTGAG GTGTCCTTGCAAGTGCTGGATGCTGTGGTCTGCTACAACTGCTTACCAGCCGAGAGCCTGCCTCTGTTCATTATCACCCTGTGCC

GCACCATCAATGTCAAGGAGCTGTGTGAGCCTTGCTGGAAG TTGATGCGTAACCTTCTGGGCACCCACCTGGGCCACAGCGCCATCTACAACATGTGCC

GCATCATGGAGGACAG ATCCTACATGGAAGATGCCCCACTGCTGAGAGGAGCTGTGTTCTTTGTAGGGATGGCACTCTGGGGAGCTCACCGGCTCTACT

CTCTCAAGAACTCCCCCACATCTGTGCTGCCGTCTTTTTATGAG GCTATGACCTGTCCCAATGAGGTGGTGTCATATGAGATTGTTCTGTCCATAACAA

GACTCATCAAGAAGTATAGGAAGGAGCTCCAGGCTGTGACATGGGATATTCTGCTGGACATCATTGAACGACTACTTCAGCAACTCCAG AACCTGGACA

GCCCGGAACTCAAGACCATCGTCCATGACCTGCTGACCACTGTGGAGGAGCTATGTGACCAGAACGAGTTCCATGGCTCGCAGGAAAGATACTATGAACT

GGTGGAGAGCTATGCAGACCAGAGACCT GAATCCTCTCTCTTAAACTTGATATCCTACAGAGCCCAGTCCATCCACCCTGCCAAGGATGGCTGGATCCA

GAACTTGCAGTTGTTGATGGAGAGGTTCTTCAG GAATGAGTGCCGCAGCGCCGTGCGCATCAAGGTGTTGGATGTTCTGTCCTTCGTGCTGCTGATCAA

CAGGCAGTTCTATGAG GAGGAGCTGATTAACTCGGTGGTCATCTCGCAGCTCTCCCACATTCCCGAGGATAAGGACCATCAGGTCCGAAAGCTGGCTAC

TCAGCTGCTGGTGGACCTGGCAGAGGGGTGCCACACCCACCACTTCAACAGTCTGCTGGACATCATTGAAAAG ACCAAGCTCTACACCTTGCCTGCCAG

CCACGCCACTCGAGTGTATGAGAGCCTCATTAGTCACATCCAGCTCCATTACAAGCACGGCTACTCCCTGCCCATTGCTAGCAGCATCCGACTACAG GC

CTTTGACTTCCTGCTGCTACTGCGGGCTGACTCGCTGCATCGACTGGGCCTGCCCAACAAGGATGGGGTCGTGAGATTCAGCCCTTACTGCCTCTGTGAC

TGCAT GGAACTGGATAGAGCCTCAGAGAAGAAAGCCAGTGGGCCCCTTTCACCTCCAACTGGGCCCCCTAGCCCTGTGCCTATGGGCCCTGCTGTGCGG

CTCGGCTACCTACCCTACTCCCTGCTCTTCCGTGTCCTGTTGCAGTGTTTGAAGCAG GAGAGCGACTGGAAGGTGCTGAAGCTGGTGCTCAGCAGGCTG

CCGGAGTCACTGCGCTACAAAGTCCTCATCTTCACCTCCCCCTGCAGTGTCGACCAGCTGTCTTCTGCCCTCTGCTCCATG CTTTCAGCTCCAAAGACC

CTTGAGCGGCTCCGAGGTACCCCAGAAGGCTTCTCGAGAACTGACCTGCACTTGGCTGTGGTTCCCGTGCTAACAGCATTAATATCTTATCACAACTATT

TGGACAAGACCAGACAG CGTGAGATGGTGTACTGCCTGGAACAAGGCCTTATCTACCGCTGCGCCAGCCAGTGCGTGGTAGCCTTGGCCATCTGCAGTG

TGGAGATGCCCGACATCATCATCAAGGCGCTTCCTGTCCTGGTGGTGAAGCTCACACACATTTCTGCCACAGCCAGCATGGCCATCCCGCTCCTGGAGTT

CCTGTCTA CTTTGGCCAGGCTGCCCCACCTCTACAGGAACTTTGCTGCAGAGCAGTATGCCAGCGTGTTTGCCATCTCCTTGCCATACACCAACCCCTC

CAA GTTCAACCAGTACATTGTGTGTCTGGCTCACCACGTCATAGCCATGTGGTTCATCAGGTGCCGACTGCCCTTTCGGAAGGATTTCGTCCCTTATAT

CACTAAG GGTTTGCGTTCCAATGTCCTCCTGTCTTTTGATGATACCCCTGAGAAGGACAGTTTCAGAGCACGGAGCACCAGTCTTAATGAGAGACCCAA

AAG TTTGAGGATAGCCAGAGCCCCCAAACAAGGCCTGAATAACTCTCCACCTGTGAAAGAATTCAAAGAGAGCTGTGCAGCCGAGGCCTTCCGGTGCCG

CAGCATCAGTGTATCTGAACATGTGGTCCGCAG CAGAATACAGACATCCCTTACGAGCGCCAGCCTGGGGTCTGCGGATGAGAACTCTATGGCCCAGGC

TGATGACAACTTGAAGAATCTCCACTTGGAGCTCACAGAAACATGTCTGGACATGATGGCCCGATATGTGTTCTCCAATTTCACTGCAGTCCCCAAGAG 

GTCCCCTGTGGGAGAGTTCCTCCTGGCAGGGGGTAGGACCAAAACCTGGCTGGTTGGAAACAAGCTTGTCACTGTGACAACAAGTGTGGGAACTGGTACA

CGGTCGCTGCTGGGCCTGGACTCTGGGGACCTGCAGGGTGGCTCGGATTCAAG CTCTGATCCTAGCACACATGTGAGGCAGACAAAGGAAGCACCGGCC

AAACTGGAGTCCCAGGCTGGGCAGCAGGTGTCCCGTGGGGCCCGGGACCGGGTCCGCTCCATGTCAG GGGGCCATGGCCTTCGAGTTGGTGTCCTGGAT

ACTTCAGCTCCCTATTCCCCAGGTGGCTCTGCTTCTCTGGGACCACAGACGGCGGTGGCAGCGAAGCCCGAGAAGCCCCCTGCAGGAGCCCAGCTTCCAA

CAGCAGAGAAGACGAATCTGGCAGCCTATGTGCCTTTGTTAACCCAGGGCTGGGCAGAAATCTTAGTCCGCAGACCCACAG GAAACACCAGCTGGCTGA

TGAGCTTGGAGAACCCGCTCAGCCCCTTCTCCTCAGACATCAACAACATGCCCCTGCAAGAGCTGTCCAATGCCCTTATGGCTGCTGAACGTTTCAAGGA

GCAC GGACACGGCCCTGTACAAGTCATTGTCAGTGCCAGCGGCTGG ACCGCCAAGCCTCCTACTCTCCCACGCTCTAATACAG TGGCTTCTTTCTCC

TCCCTGTACCAGCCCAGCTGCCAAGGACAGCTGCACAGGAGCGTTTCCTGGGCAG ACTCAGCCATGGTCCTTGAGGAGGGAAGTCCAGGAGAGACTCAG

GTGCCAGTGGAGCCCCCCGAATTGGAGGATTTCGAGGCGGCGTTAGGTACAGACAGGCACTGCCAGCGGCCTGACACCTACAGCCGG TCATCCTCAGCA

TCTAGCCAGGAAGAAAAGTCCCATTTGGAGGAGCTTGCTGCAGGGGGTATCCCCATTGAGCGGGCCATCTCCTCTGAGGGGGCTCGGCCTGCCGTGGACC

TCTCCTTCCAACCCTCACAGCCTTTGAGCAAGTCTAGCTCTTCTCCGGAGTTGCAGACCTTACAGGACATCCTTGGAGACCTAGGGGACAAGATTGATAT

TGGACGGCTGAGTCCTGAGGCTAAGGTCCGGTCCCAGTCAGGGATCCTGGATGGGGAAGCAGCTACCTGGTCAGCTACGGGTGAAGAGAGCCGTATCACA

GTCCCACCTGAAGGTCCTCTGCCTTCCAGTTCTCCCCGCTCCCCCAGTGGCCTCCGGCCCCGAGGCTATACCATCTCTGATTCCGCTCCATCACGAAGGG

GAAAGAGGGTAGAAAGGGATAACTTCAAGAGCAGAGCTGCGGCCTCCAGTGCTGAGAAGGTGCCAGGCATCAACCCTAG CTTTGTGTTCCTACAGCTCT

ACCATTCGCCCTTTTTTGGTGATGAGTCCAATAAGCCCATCCTATTGCCCAATGAG TCCTTTGAACGGTCAGTACAGCTGCTTGACCAGATTCCATCCT

ATGACACTCACAAGATTGCTGTCCTGTATGTGGGAGAAGGCCAG AGCAGCAGTGAGCTGGCCATCCTGTCAAATGAGCATGGCTCTTACAGGTACACGG

AGTTTCTGACAGGCCTGGGTCGGCTTATTGAGCTCAAGGACTGCCAACCAGACAAGGTGTACTTAGGTGGACTGGATGTATGTGGCGAGGATGGACAGTT

CACCTACTGCTGGCATGATGACATCATGCAAG CTGTTTTCCACATTGCCACCCTGATGCCCACCAAGGATGTGGACAAGCACCGCTGTGACAAGAAACG

GCACCTGGGCAATGACTTTGTTTCTATCATCTACAATGATTCTGGTGAGGACTTCAAACTGGGCACCATTAAG CAGGGCCAGTTCAACTTTGTCCATGT

GATCATCACACCGCTGGACTACAAGTGCAACCTATTGACCCTGCAGTGCAGGAAAG ATGGCCCTGCATGCAAATGTGAGTGGTGGCGGCAGCCTGGGGA

GATAGTCGTGTGGGCGCTCCCTGTTGTGATGGAGCTCACTGTCACCATCCTGCTCTGTCACCTCCAGATGGCCTCACAGGTACACCACAGCCGATCCAAC

CCCACTGACATCTATCCCTCCAAGTGGATCGCAAGACTCCGCCACATTAAGCGTCTCCGCCAGAGG ATCCGTGAAGAGGTGCACTATTCCAACCCAAGC

TTGCCTCTGATGCACCCTCCAGCCCACACCAAAGCCCCAGCTCAAGCCCCTGAGGCTACACCCACCTATGAAACAGGCCAGCGGAAGCGCCTCATTTCCT

CCGTGGATGACTTCACAGAGTTTGTGTGAGGCCAGCAGATCCATGACTAGAGTCCTGTGGCCAGCCATGTAGCTATCCTGACTGTACTCCTACATGAAAT

AAACTGCACACGCACATCTGGCCCGTGGAGTTCAGAGAGCAGCACAGACAGCAGTCAGACAGCTTCTTTATTTGACTTTGTCTTGTCTGTTTGGGGTTGG

GGCAGAATCCAGGCTAGAGCTGCAGATGAGCCCACAGAAGCAGGCAGGTGCCATCACATACATTCTCTTTCCCCCACCCGCCATGGGGGCAAGCCCCATT

GGTGGGCTTGTCCAGTAACTTCTTGGCATCTTTCATCCCACAGTAGTCCTGCCCTTGCTCAGATCTGAAACCAGCAGATCTGCGTGCTGCCTGGCCCCAG

ACAAGGGAGGAAAACAAGGCCACGGTGGCCCCAATTGCTGTCCAGCACCTGCCCGAGGCCAGACTCGGATCCAGTAATAGCTGCAGCTTCCCCTGTACCC

CTGCCCTGGGTAACAATGGACCCATTTTCAGCCCAAGTAGAAAATACTGACATACAAAAATATATACATTTTAACCCCATATAAATTATTGATGGTGGAC

ATAGAAAGCAGATGGTAGCTAGAGGGCAAGTATGCTGCAGAAACAAGAGAGGTAATAACTTAGGGGACGGATAAAGGAGAAGTGTAGCTTAGCCCTC
Translation
 - UNI15458 - MAKPTSKDSGLKEKFKILLGLGTSRPNPRCAEGKQTEFIITSEILR - UNI15458 - ELSGECGLNNRIRMIGQICDVAKTKK

LEE - UNI15458 - HAVEALWKAVSDLLQPERPPEARHAVLTLLKAIVQGQ GDRLGVLRALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLE

EELA AEFVLQWMDVGLSSEFLLVLVNLVKFNSCYLDEYIASMVH HMICLLCIRTVSSVDIE VSLQVLDAVVCYNCLPAESLPLFIITLCRTINVKEL

CEPCWK LMRNLLGTHLGHSAIYNMCRIMEDR RSYMEDAPLLRGAVFFVGMALWGAHRLYSLKNSPTSVLPSFYE AMTCPNEVVSYEIVLSITRLIKK

YRKELQAVTWDILLDIIERLLQQLQ NLDSPELKTIVHDLLTTVEELCDQNEFHGSQERYYELVESYADQRP ESSLLNLISYRAQSIHPAKDGWIQNLQ

LLMERFFR RNECRSAVRIKVLDVLSFVLLINRQFYE EELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEK TKLYTLPAS

HATRVYESLISHIQLHYKHGYSLPIASSIRLQ AFDFLLLLRADSLHRLGLPNKDGVVRFSPYCLCDCM MELDRASEKKASGPLSPPTGPPSPVPMGPA

VRLGYLPYSLLFRVLLQCLKQ ESDWKVLKLVLSRLPESLRYKVLIFTSPCSVDQLSSALCSM LSAPKTLERLRGTPEGFSRTDLHLAVVPVLTALISY

HNYLDKTRQ REMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISATASMAIPLLEFLST TLARLPHLYRNFAAEQYASVFAISL

PYTNPSK KFNQYIVCLAHHVIAMWFIRCRLPFRKDFVPYITK GLRSNVLLSFDDTPEKDSFRARSTSLNERPKS SLRIARAPKQGLNNSPPVKEFKE

SCAAEAFRCRSISVSEHVVRS SRIQTSLTSASLGSADENSMAQADDNLKNLHLELTETCLDMMARYVFSNFTAVPKR RSPVGEFLLAGGRTKTWLVGN

KLVTVTTSVGTGTRSLLGLDSGDLQGGSDSS SSDPSTHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSG GGHGLRVGVLDTSAPYSPGGSASLGPQT

AVAAKPEKPPAGAQLPTAEKTNLAAYVPLLTQGWAEILVRRPTG GNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEH GHGPVQVIVSASG

W TAKPPTLPRSNTV VASFSSLYQPSCQGQLHRSVSWAD DSAMVLEEGSPGETQVPVEPPELEDFEAALGTDRHCQRPDTYSR SSSASSQEEKSHLE

ELAAGGIPIERAISSEGARPAVDLSFQPSQPLSKSSSSPELQTLQDILGDLGDKIDIGRLSPEAKVRSQSGILDGEAATWSATGEESRITVPPEGPLPSS

SPRSPSGLRPRGYTISDSAPSRRGKRVERDNFKSRAAASSAEKVPGINPS SFVFLQLYHSPFFGDESNKPILLPNE SFERSVQLLDQIPSYDTHKIAV

LYVGEGQ SSSELAILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQA AVFHIATLMPTKDVDKHRCDKKRHLGND

FVSIIYNDSGEDFKLGTIK QGQFNFVHVIITPLDYKCNLLTLQCRKD DGPACKCEWWRQPGEIVVWALPVVMELTVTILLCHLQMASQVHHSRSNPTD

IYPSKWIARLRHIKRLRQR IREEVHYSNPSLPLMHPPAHTKAPAQAPEATPTYETGQRKRLISSVDDFTEFV
Transcript ENSMUST00000115292
Sequence
GTACGGGTTGCGCTTCCGGCAGCTGCCCTGGGCCGGGGGTGTGCGCCCTTCCCTGGGTGCAGGAGGACCTGCGCGCGAAAGGCGCGCGCGGG - UNI15

458 - AGCAGTTCTCTAGTACTGCCCTGCCCACCATGGCCAAACCAACAAGCAAAGATTCCGGCTTGAAGGAGAAGTTCAAGATACTGTTGGGATTGGG

AACATCGAGGCCAAATCCCAGGTGTGCAGAAGGCAAACAGACTGAGTTTATCATCACATCGGAAATCTTGAGA - UNI15458 - GAACTGAGTGGTG

AATGCGGCCTCAACAATCGCATCCGAATGATAGGGCAGATCTGTGATGTGGCAAAAACTAAGAAGCTTGAGGAG - UNI15458 - GGTGATCGTTTG

GGAGTTCTCAGAGCCCTCTTCTTCAAAGTGATCAAGGACTACCCCTCCAATGAAGACCTCCATGAAAGGCTAGAAGTTTTTAAGGCCCTCACAGACAATG

GGAGGCACATTACCTATTTGGAAGAAGAACTGG CAGAGTTTGTCCTGCAGTGGATGGATGTTGGCTTGTCCTCAGAATTCCTTCTGGTACTTGTCAACC

TGGTCAAGTTCAACAGCTGTTACCTTGACGAATACATTGCATCAATGGTTCA CATGATTTGTCTGCTATGCATCCGGACAGTGTCCTCTGTGGACATTG

AG GTGTCCTTGCAAGTGCTGGATGCTGTGGTCTGCTACAACTGCTTACCAGCCGAGAGCCTGCCTCTGTTCATTATCACCCTGTGCCGCACCATCAATG

TCAAGGAGCTGTGTGAGCCTTGCTGGAAG TTGATGCGTAACCTTCTGGGCACCCACCTGGGCCACAGCGCCATCTACAACATGTGCCGCATCATGGAGG

ACAG ATCCTACATGGAAGATGCCCCACTGCTGAGAGGAGCTGTGTTCTTTGTAGGGATGGCACTCTGGGGAGCTCACCGGCTCTACTCTCTCAAGAACT

CCCCCACATCTGTGCTGCCGTCTTTTTATGAG GCTATGACCTGTCCCAATGAGGTGGTGTCATATGAGATTGTTCTGTCCATAACAAGACTCATCAAGA

AGTATAGGAAGGAGCTCCAGGCTGTGACATGGGATATTCTGCTGGACATCATTGAACGACTACTTCAGCAACTCCAG AACCTGGACAGCCCGGAACTCA

AGACCATCGTCCATGACCTGCTGACCACTGTGGAGGAGCTATGTGACCAGAACGAGTTCCATGGCTCGCAGGAAAGATACTATGAACTGGTGGAGAGCTA

TGCAGACCAGAGACCT GAATCCTCTCTCTTAAACTTGATATCCTACAGAGCCCAGTCCATCCACCCTGCCAAGGATGGCTGGATCCAGAACTTGCAGTT

GTTGATGGAGAGGTTCTTCAG GAATGAGTGCCGCAGCGCCGTGCGCATCAAGGTGTTGGATGTTCTGTCCTTCGTGCTGCTGATCAACAGGCAGTTCTA

TGAG GAGGAGCTGATTAACTCGGTGGTCATCTCGCAGCTCTCCCACATTCCCGAGGATAAGGACCATCAGGTCCGAAAGCTGGCTACTCAGCTGCTGGT

GGACCTGGCAGAGGGGTGCCACACCCACCACTTCAACAGTCTGCTGGACATCATTGAAAAG GTGATGGCGCGCTCACTCTCTCCACCCCCGGAGCTGGA

AGAAAGGGACCTGGCCATGCACTCGGCCTCCCTGGAGGACGTGAAGACCGCGGTCCTGGGGCTCCTGGTCATCCTTCAG ACCAAGCTCTACACCTTGCC

TGCCAGCCACGCCACTCGAGTGTATGAGAGCCTCATTAGTCACATCCAGCTCCATTACAAGCACGGCTACTCCCTGCCCATTGCTAGCAGCATCCGACTA

CAG GCCTTTGACTTCCTGCTGCTACTGCGGGCTGACTCGCTGCATCGACTGGGCCTGCCCAACAAGGATGGGGTCGTGAGATTCAGCCCTTACTGCCTC

TGTGACTGCAT GGAACTGGATAGAGCCTCAGAGAAGAAAGCCAGTGGGCCCCTTTCACCTCCAACTGGGCCCCCTAGCCCTGTGCCTATGGGCCCTGCT

GTGCGGCTCGGCTACCTACCCTACTCCCTGCTCTTCCGTGTCCTGTTGCAGTGTTTGAAGCAG GAGAGCGACTGGAAGGTGCTGAAGCTGGTGCTCAGC

AGGCTGCCGGAGTCACTGCGCTACAAAGTCCTCATCTTCACCTCCCCCTGCAGTGTCGACCAGCTGTCTTCTGCCCTCTGCTCCATG CTTTCAGCTCCA

AAGACCCTTGAGCGGCTCCGAGGTACCCCAGAAGGCTTCTCGAGAACTGACCTGCACTTGGCTGTGGTTCCCGTGCTAACAGCATTAATATCTTATCACA

ACTATTTGGACAAGACCAGACAG CGTGAGATGGTGTACTGCCTGGAACAAGGCCTTATCTACCGCTGCGCCAGCCAGTGCGTGGTAGCCTTGGCCATCT

GCAGTGTGGAGATGCCCGACATCATCATCAAGGCGCTTCCTGTCCTGGTGGTGAAGCTCACACACATTTCTGCCACAGCCAGCATGGCCATCCCGCTCCT

GGAGTTCCTGTCTA CTTTGGCCAGGCTGCCCCACCTCTACAGGAACTTTGCTGCAGAGCAGTATGCCAGCGTGTTTGCCATCTCCTTGCCATACACCAA

CCCCTCCAA GTTCAACCAGTACATTGTGTGTCTGGCTCACCACGTCATAGCCATGTGGTTCATCAGGTGCCGACTGCCCTTTCGGAAGGATTTCGTCCC

TTATATCACTAAG GGTTTGCGTTCCAATGTCCTCCTGTCTTTTGATGATACCCCTGAGAAGGACAGTTTCAGAGCACGGAGCACCAGTCTTAATGAGAG

ACCCAAAAG TTTGAGGATAGCCAGAGCCCCCAAACAAGGCCTGAATAACTCTCCACCTGTGAAAGAATTCAAAGAGAGCTGTGCAGCCGAGGCCTTCCG

GTGCCGCAGCATCAGTGTATCTGAACATGTGGTCCGCAG CAGAATACAGACATCCCTTACGAGCGCCAGCCTGGGGTCTGCGGATGAGAACTCTATGGC

CCAGGCTGATGACAACTTGAAGAATCTCCACTTGGAGCTCACAGAAACATGTCTGGACATGATGGCCCGATATGTGTTCTCCAATTTCACTGCAGTCCCC

AAGAG GTCCCCTGTGGGAGAGTTCCTCCTGGCAGGGGGTAGGACCAAAACCTGGCTGGTTGGAAACAAGCTTGTCACTGTGACAACAAGTGTGGGAACT

GGTACACGGTCGCTGCTGGGCCTGGACTCTGGGGACCTGCAGGGTGGCTCGGATTCAAG CTCTGATCCTAGCACACATGTGAGGCAGACAAAGGAAGCA

CCGGCCAAACTGGAGTCCCAGGCTGGGCAGCAGGTGTCCCGTGGGGCCCGGGACCGGGTCCGCTCCATGTCAG GGGGCCATGGCCTTCGAGTTGGTGTC

CTGGATACTTCAGCTCCCTATTCCCCAGGTGGCTCTGCTTCTCTGGGACCACAGACGGCGGTGGCAGCGAAGCCCGAGAAGCCCCCTGCAGGAGCCCAGC

TTCCAACAGCAGAGAAGACGAATCTGGCAGCCTATGTGCCTTTGTTAACCCAGGGCTGGGCAGAAATCTTAGTCCGCAGACCCACAG GAAACACCAGCT

GGCTGATGAGCTTGGAGAACCCGCTCAGCCCCTTCTCCTCAGACATCAACAACATGCCCCTGCAAGAGCTGTCCAATGCCCTTATGGCTGCTGAACGTTT

CAAGGAGCAC GGACACGGCCCTGTACAAGTCATTGTCAGTGCCAGCGGCTGG ACCGCCAAGCCTCCTACTCTCCCACGCTCTAATACAG TGGCTTCT

TTCTCCTCCCTGTACCAGCCCAGCTGCCAAGGACAGCTGCACAGGAGCGTTTCCTGGGCAG ACTCAGCCATGGTCCTTGAGGAGGGAAGTCCAGGAGAG

ACTCAGGTGCCAGTGGAGCCCCCCGAATTGGAGGATTTCGAGGCGGCGTTAGGTACAGACAGGCACTGCCAGCGGCCTGACACCTACAGCCGG TCATCC

TCAGCATCTAGCCAGGAAGAAAAGTCCCATTTGGAGGAGCTTGCTGCAGGGGGTATCCCCATTGAGCGGGCCATCTCCTCTGAGGGGGCTCGGCCTGCCG

TGGACCTCTCCTTCCAACCCTCACAGCCTTTGAGCAAGTCTAGCTCTTCTCCGGAGTTGCAGACCTTACAGGACATCCTTGGAGACCTAGGGGACAAGAT

TGATATTGGACGGCTGAGTCCTGAGGCTAAGGTCCGGTCCCAGTCAGGGATCCTGGATGGGGAAGCAGCTACCTGGTCAGCTACGGGTGAAGAGAGCCGT

ATCACAGTCCCACCTGAAGGTCCTCTGCCTTCCAGTTCTCCCCGCTCCCCCAGTGGCCTCCGGCCCCGAGGCTATACCATCTCTGATTCCGCTCCATCAC

GAAGGGGAAAGAGGGTAGAAAGGGATAACTTCAAGAGCAGAGCTGCGGCCTCCAGTGCTGAGAAGGTGCCAGGCATCAACCCTAG CTTTGTGTTCCTAC

AGCTCTACCATTCGCCCTTTTTTGGTGATGAGTCCAATAAGCCCATCCTATTGCCCAATGAG TCCTTTGAACGGTCAGTACAGCTGCTTGACCAGATTC

CATCCTATGACACTCACAAGATTGCTGTCCTGTATGTGGGAGAAGGCCAG AGCAGCAGTGAGCTGGCCATCCTGTCAAATGAGCATGGCTCTTACAGGT

ACACGGAGTTTCTGACAGGCCTGGGTCGGCTTATTGAGCTCAAGGACTGCCAACCAGACAAGGTGTACTTAGGTGGACTGGATGTATGTGGCGAGGATGG

ACAGTTCACCTACTGCTGGCATGATGACATCATGCAAG CTGTTTTCCACATTGCCACCCTGATGCCCACCAAGGATGTGGACAAGCACCGCTGTGACAA

GAAACGGCACCTGGGCAATGACTTTGTTTCTATCATCTACAATGATTCTGGTGAGGACTTCAAACTGGGCACCATTAAG CAGGGCCAGTTCAACTTTGT

CCATGTGATCATCACACCGCTGGACTACAAGTGCAACCTATTGACCCTGCAGTGCAGGAAAG ATGGCCCTGCATGCAAATGTGAGTGGTGGCGGCAGCC

TGGGGAGATAGTCGTGTGGGCGCTCCCTGTTGTGATGGAGCTCACTGTCACCATCCTGCTCTGTCACCTCCAGATGGCCTCACAGGTACACCACAGCCGA

TCCAACCCCACTGACATCTATCCCTCCAAGTGGATCGCAAGACTCCGCCACATTAAGCGTCTCCGCCAGAGG ATCCGTGAAGAGGTGCACTATTCCAAC

CCAAGCTTGCCTCTGATGCACCCTCCAGCCCACACCAAAGCCCCAGCTCAAGCCCCTGAGGCTACACCCACCTATGAAACAGGCCAGCGGAAGCGCCTCA

TTTCCTCCGTGGATGACTTCACAGAGTTTGTGTGAGGCCAGCAGATCCATGACTAGAGTCCTGTGGCCAGCCATGTAGCTATCCTGACTGTACTCCTACA

TGAAATAAACTGCACACGCACATCTGGCCCGTGGAGTTCAGAGAGCAGCACAGACAGCAGTCAGACAGCTTCTTTATTTGACTTTGTCTTGTCTGTTTGG

GGTTGGGGCAGAATCCAGGCTAGAGCTGCAGATGAGCCCACAGAAGCAGGCAGGTGCCATCACATACATTCTCTTTCCCCCACCCGCCATGGGGGCAAGC

CCCATTGGTGGGCTTGTCCAGTAACTTCTTGGCATCTTTCATCCCACAGTAGTCCTGCCCTTGCTCAGATCTGAAACCAGCAGATCTGCGTGCTGCCTGG

CCCCAGACAAGGGAGGAAAACAAGGCCACGGTGGCCCCAATTGCTGTCCAGCACCTGCCCGAGGCCAGACTCGGATCCAGTAATAGCTGCAGCTTCCCCT

GTACCCCTGCCCTGGGTAACAATGGACCCATTTTCAGCCCAAGTAGAAAATACTGACATACAAAAATATATACATTTTAACCCCATATAAATTATTGATG

GTGGACATAGAAAGCAGATGGTAGCTAGAGGGCAAGTATGCTGCAGAAACAAGAGAGGTAATAACTTAGGGGACGGATAAAGGAGAAGTGTAGCTTAGCC

CTC
Translation
 - UNI15458 - MAKPTSKDSGLKEKFKILLGLGTSRPNPRCAEGKQTEFIITSEILR - UNI15458 - ELSGECGLNNRIRMIGQICDVAKTKK

LEE - UNI15458 - GDRLGVLRALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELA AEFVLQWMDVGLSSEFLLVLVNLVKFNSCYLDE

YIASMVH HMICLLCIRTVSSVDIE VSLQVLDAVVCYNCLPAESLPLFIITLCRTINVKELCEPCWK LMRNLLGTHLGHSAIYNMCRIMEDR RSYME

DAPLLRGAVFFVGMALWGAHRLYSLKNSPTSVLPSFYE AMTCPNEVVSYEIVLSITRLIKKYRKELQAVTWDILLDIIERLLQQLQ NLDSPELKTIVH

DLLTTVEELCDQNEFHGSQERYYELVESYADQRP ESSLLNLISYRAQSIHPAKDGWIQNLQLLMERFFR RNECRSAVRIKVLDVLSFVLLINRQFYE 

EELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEK VMARSLSPPPELEERDLAMHSASLEDVKTAVLGLLVILQ TKLYTLP

ASHATRVYESLISHIQLHYKHGYSLPIASSIRLQ AFDFLLLLRADSLHRLGLPNKDGVVRFSPYCLCDCM MELDRASEKKASGPLSPPTGPPSPVPMG

PAVRLGYLPYSLLFRVLLQCLKQ ESDWKVLKLVLSRLPESLRYKVLIFTSPCSVDQLSSALCSM LSAPKTLERLRGTPEGFSRTDLHLAVVPVLTALI

SYHNYLDKTRQ REMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISATASMAIPLLEFLST TLARLPHLYRNFAAEQYASVFAI

SLPYTNPSK KFNQYIVCLAHHVIAMWFIRCRLPFRKDFVPYITK GLRSNVLLSFDDTPEKDSFRARSTSLNERPKS SLRIARAPKQGLNNSPPVKEF

KESCAAEAFRCRSISVSEHVVRS SRIQTSLTSASLGSADENSMAQADDNLKNLHLELTETCLDMMARYVFSNFTAVPKR RSPVGEFLLAGGRTKTWLV

GNKLVTVTTSVGTGTRSLLGLDSGDLQGGSDSS SSDPSTHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSG GGHGLRVGVLDTSAPYSPGGSASLGP

QTAVAAKPEKPPAGAQLPTAEKTNLAAYVPLLTQGWAEILVRRPTG GNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEH GHGPVQVIVSA

SGW TAKPPTLPRSNTV VASFSSLYQPSCQGQLHRSVSWAD DSAMVLEEGSPGETQVPVEPPELEDFEAALGTDRHCQRPDTYSR SSSASSQEEKSH

LEELAAGGIPIERAISSEGARPAVDLSFQPSQPLSKSSSSPELQTLQDILGDLGDKIDIGRLSPEAKVRSQSGILDGEAATWSATGEESRITVPPEGPLP

SSSPRSPSGLRPRGYTISDSAPSRRGKRVERDNFKSRAAASSAEKVPGINPS SFVFLQLYHSPFFGDESNKPILLPNE SFERSVQLLDQIPSYDTHKI

AVLYVGEGQ SSSELAILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQA AVFHIATLMPTKDVDKHRCDKKRHLG

NDFVSIIYNDSGEDFKLGTIK QGQFNFVHVIITPLDYKCNLLTLQCRKD DGPACKCEWWRQPGEIVVWALPVVMELTVTILLCHLQMASQVHHSRSNP

TDIYPSKWIARLRHIKRLRQR IREEVHYSNPSLPLMHPPAHTKAPAQAPEATPTYETGQRKRLISSVDDFTEFV
Transcript ENSMUST00000115294
Sequence
GTACGGGTTGCGCTTCCGGCAGCTGCCCTGGGCCGGGGGTGTGCGCCCTTCCCTGGGTGCAGGAGGACCTGCGCGCGAAAGGCGCGCGCGGG - UNI15

458 - AGCAGTTCTCTAGTACTGCCCTGCCCACCATGGCCAAACCAACAAGCAAAGATTCCGGCTTGAAGGAGAAGTTCAAGATACTGTTGGGATTGGG

AACATCGAGGCCAAATCCCAGGTGTGCAGAAGGCAAACAGACTGAGTTTATCATCACATCGGAAATCTTGAGA - UNI15458 - GAACTGAGTGGTG

AATGCGGCCTCAACAATCGCATCCGAATGATAGGGCAGATCTGTGATGTGGCAAAAACTAAGAAGCTTGAGGAG - UNI15458 - CATGCAGTGGAG

GCACTTTGGAAGGCTGTCTCAGACTTGCTACAGCCAGAGCGGCCACCAGAGGCCCGGCATGCAGTTCTCACCTTATTGAAGGCCATTGTACAGGGACAG 

GGTGATCGTTTGGGAGTTCTCAGAGCCCTCTTCTTCAAAGTGATCAAGGACTACCCCTCCAATGAAGACCTCCATGAAAGGCTAGAAGTTTTTAAGGCCC

TCACAGACAATGGGAGGCACATTACCTATTTGGAAGAAGAACTGG CAGAGTTTGTCCTGCAGTGGATGGATGTTGGCTTGTCCTCAGAATTCCTTCTGG

TACTTGTCAACCTGGTCAAGTTCAACAGCTGTTACCTTGACGAATACATTGCATCAATGGTTCA CATGATTTGTCTGCTATGCATCCGGACAGTGTCCT

CTGTGGACATTGAG GTGTCCTTGCAAGTGCTGGATGCTGTGGTCTGCTACAACTGCTTACCAGCCGAGAGCCTGCCTCTGTTCATTATCACCCTGTGCC

GCACCATCAATGTCAAGGAGCTGTGTGAGCCTTGCTGGAAG TTGATGCGTAACCTTCTGGGCACCCACCTGGGCCACAGCGCCATCTACAACATGTGCC

GCATCATGGAGGACAG ATCCTACATGGAAGATGCCCCACTGCTGAGAGGAGCTGTGTTCTTTGTAGGGATGGCACTCTGGGGAGCTCACCGGCTCTACT

CTCTCAAGAACTCCCCCACATCTGTGCTGCCGTCTTTTTATGAG GCTATGACCTGTCCCAATGAGGTGGTGTCATATGAGATTGTTCTGTCCATAACAA

GACTCATCAAGAAGTATAGGAAGGAGCTCCAGGCTGTGACATGGGATATTCTGCTGGACATCATTGAACGACTACTTCAGCAACTCCAG AACCTGGACA

GCCCGGAACTCAAGACCATCGTCCATGACCTGCTGACCACTGTGGAGGAGCTATGTGACCAGAACGAGTTCCATGGCTCGCAGGAAAGATACTATGAACT

GGTGGAGAGCTATGCAGACCAGAGACCT GAATCCTCTCTCTTAAACTTGATATCCTACAGAGCCCAGTCCATCCACCCTGCCAAGGATGGCTGGATCCA

GAACTTGCAGTTGTTGATGGAGAGGTTCTTCAG GAATGAGTGCCGCAGCGCCGTGCGCATCAAGGTGTTGGATGTTCTGTCCTTCGTGCTGCTGATCAA

CAGGCAGTTCTATGAG GAGGAGCTGATTAACTCGGTGGTCATCTCGCAGCTCTCCCACATTCCCGAGGATAAGGACCATCAGGTCCGAAAGCTGGCTAC

TCAGCTGCTGGTGGACCTGGCAGAGGGGTGCCACACCCACCACTTCAACAGTCTGCTGGACATCATTGAAAAG GTGATGGCGCGCTCACTCTCTCCACC

CCCGGAGCTGGAAGAAAGGGACCTGGCCATGCACTCGGCCTCCCTGGAGGACGTGAAGACCGCGGTCCTGGGGCTCCTGGTCATCCTTCAG ACCAAGCT

CTACACCTTGCCTGCCAGCCACGCCACTCGAGTGTATGAGAGCCTCATTAGTCACATCCAGCTCCATTACAAGCACGGCTACTCCCTGCCCATTGCTAGC

AGCATCCGACTACAG GCCTTTGACTTCCTGCTGCTACTGCGGGCTGACTCGCTGCATCGACTGGGCCTGCCCAACAAGGATGGGGTCGTGAGATTCAGC

CCTTACTGCCTCTGTGACTGCAT GGAACTGGATAGAGCCTCAGAGAAGAAAGCCAGTGGGCCCCTTTCACCTCCAACTGGGCCCCCTAGCCCTGTGCCT

ATGGGCCCTGCTGTGCGGCTCGGCTACCTACCCTACTCCCTGCTCTTCCGTGTCCTGTTGCAGTGTTTGAAGCAG GAGAGCGACTGGAAGGTGCTGAAG

CTGGTGCTCAGCAGGCTGCCGGAGTCACTGCGCTACAAAGTCCTCATCTTCACCTCCCCCTGCAGTGTCGACCAGCTGTCTTCTGCCCTCTGCTCCATG 

CTTTCAGCTCCAAAGACCCTTGAGCGGCTCCGAGGTACCCCAGAAGGCTTCTCGAGAACTGACCTGCACTTGGCTGTGGTTCCCGTGCTAACAGCATTAA

TATCTTATCACAACTATTTGGACAAGACCAGACAG CGTGAGATGGTGTACTGCCTGGAACAAGGCCTTATCTACCGCTGCGCCAGCCAGTGCGTGGTAG

CCTTGGCCATCTGCAGTGTGGAGATGCCCGACATCATCATCAAGGCGCTTCCTGTCCTGGTGGTGAAGCTCACACACATTTCTGCCACAGCCAGCATGGC

CATCCCGCTCCTGGAGTTCCTGTCTA CTTTGGCCAGGCTGCCCCACCTCTACAGGAACTTTGCTGCAGAGCAGTATGCCAGCGTGTTTGCCATCTCCTT

GCCATACACCAACCCCTCCAA GTTCAACCAGTACATTGTGTGTCTGGCTCACCACGTCATAGCCATGTGGTTCATCAGGTGCCGACTGCCCTTTCGGAA

GGATTTCGTCCCTTATATCACTAAG GGTTTGCGTTCCAATGTCCTCCTGTCTTTTGATGATACCCCTGAGAAGGACAGTTTCAGAGCACGGAGCACCAG

TCTTAATGAGAGACCCAAAAG TTTGAGGATAGCCAGAGCCCCCAAACAAGGCCTGAATAACTCTCCACCTGTGAAAGAATTCAAAGAGAGCTGTGCAGC

CGAGGCCTTCCGGTGCCGCAGCATCAGTGTATCTGAACATGTGGTCCGCAG CAGAATACAGACATCCCTTACGAGCGCCAGCCTGGGGTCTGCGGATGA

GAACTCTATGGCCCAGGCTGATGACAACTTGAAGAATCTCCACTTGGAGCTCACAGAAACATGTCTGGACATGATGGCCCGATATGTGTTCTCCAATTTC

ACTGCAGTCCCCAAGAG GTCCCCTGTGGGAGAGTTCCTCCTGGCAGGGGGTAGGACCAAAACCTGGCTGGTTGGAAACAAGCTTGTCACTGTGACAACA

AGTGTGGGAACTGGTACACGGTCGCTGCTGGGCCTGGACTCTGGGGACCTGCAGGGTGGCTCGGATTCAAG CTCTGATCCTAGCACACATGTGAGGCAG

ACAAAGGAAGCACCGGCCAAACTGGAGTCCCAGGCTGGGCAGCAGGTGTCCCGTGGGGCCCGGGACCGGGTCCGCTCCATGTCAG GGGGCCATGGCCTT

CGAGTTGGTGTCCTGGATACTTCAGCTCCCTATTCCCCAGGTGGCTCTGCTTCTCTGGGACCACAGACGGCGGTGGCAGCGAAGCCCGAGAAGCCCCCTG

CAGGAGCCCAGCTTCCAACAGCAGAGAAGACGAATCTGGCAGCCTATGTGCCTTTGTTAACCCAGGGCTGGGCAGAAATCTTAGTCCGCAGACCCACAG 

GAAACACCAGCTGGCTGATGAGCTTGGAGAACCCGCTCAGCCCCTTCTCCTCAGACATCAACAACATGCCCCTGCAAGAGCTGTCCAATGCCCTTATGGC

TGCTGAACGTTTCAAGGAGCAC GGACACGGCCCTGTACAAGTCATTGTCAGTGCCAGCGGCTGG ACCGCCAAGCCTCCTACTCTCCCACGCTCTAATA

CAG ACTCAGCCATGGTCCTTGAGGAGGGAAGTCCAGGAGAGACTCAGGTGCCAGTGGAGCCCCCCGAATTGGAGGATTTCGAGGCGGCGTTAGGTACAG

ACAGGCACTGCCAGCGGCCTGACACCTACAGCCGG TCATCCTCAGCATCTAGCCAGGAAGAAAAGTCCCATTTGGAGGAGCTTGCTGCAGGGGGTATCC

CCATTGAGCGGGCCATCTCCTCTGAGGGGGCTCGGCCTGCCGTGGACCTCTCCTTCCAACCCTCACAGCCTTTGAGCAAGTCTAGCTCTTCTCCGGAGTT

GCAGACCTTACAGGACATCCTTGGAGACCTAGGGGACAAGATTGATATTGGACGGCTGAGTCCTGAGGCTAAGGTCCGGTCCCAGTCAGGGATCCTGGAT

GGGGAAGCAGCTACCTGGTCAGCTACGGGTGAAGAGAGCCGTATCACAGTCCCACCTGAAGGTCCTCTGCCTTCCAGTTCTCCCCGCTCCCCCAGTGGCC

TCCGGCCCCGAGGCTATACCATCTCTGATTCCGCTCCATCACGAAGGGGAAAGAGGGTAGAAAGGGATAACTTCAAGAGCAGAGCTGCGGCCTCCAGTGC

TGAGAAGGTGCCAGGCATCAACCCTAG CTTTGTGTTCCTACAGCTCTACCATTCGCCCTTTTTTGGTGATGAGTCCAATAAGCCCATCCTATTGCCCAA

TGAG TCCTTTGAACGGTCAGTACAGCTGCTTGACCAGATTCCATCCTATGACACTCACAAGATTGCTGTCCTGTATGTGGGAGAAGGCCAG AGCAGCA

GTGAGCTGGCCATCCTGTCAAATGAGCATGGCTCTTACAGGTACACGGAGTTTCTGACAGGCCTGGGTCGGCTTATTGAGCTCAAGGACTGCCAACCAGA

CAAGGTGTACTTAGGTGGACTGGATGTATGTGGCGAGGATGGACAGTTCACCTACTGCTGGCATGATGACATCATGCAAG CTGTTTTCCACATTGCCAC

CCTGATGCCCACCAAGGATGTGGACAAGCACCGCTGTGACAAGAAACGGCACCTGGGCAATGACTTTGTTTCTATCATCTACAATGATTCTGGTGAGGAC

TTCAAACTGGGCACCATTAAG CAGGGCCAGTTCAACTTTGTCCATGTGATCATCACACCGCTGGACTACAAGTGCAACCTATTGACCCTGCAGTGCAGG

AAAG ATGGCCCTGCATGCAAATGTGAGTGGTGGCGGCAGCCTGGGGAGATAGTCGTGTGGGCGCTCCCTGTTGTGATGGAGCTCACTGTCACCATCCTG

CTCTGTCACCTCCAGATGGCCTCACAGGTACACCACAGCCGATCCAACCCCACTGACATCTATCCCTCCAAGTGGATCGCAAGACTCCGCCACATTAAGC

GTCTCCGCCAGAGG ATCCGTGAAGAGGTGCACTATTCCAACCCAAGCTTGCCTCTGATGCACCCTCCAGCCCACACCAAAGCCCCAGCTCAAGCCCCTG

AGGCTACACCCACCTATGAAACAGGCCAGCGGAAGCGCCTCATTTCCTCCGTGGATGACTTCACAGAGTTTGTGTGAGGCCAGCAGATCCATGACTAGAG

TCCTGTGGCCAGCCATGTAGCTATCCTGACTGTACTCCTACATGAAATAAACTGCACACGCACATCTGGCCCGTGGAGTTCAGAGAGCAGCACAGACAGC

AGTCAGACAGCTTCTTTATTTGACTTTGTCTTGTCTGTTTGGGGTTGGGGCAGAATCCAGGCTAGAGCTGCAGATGAGCCCACAGAAGCAGGCAGGTGCC

ATCACATACATTCTCTTTCCCCCACCCGCCATGGGGGCAAGCCCCATTGGTGGGCTTGTCCAGTAACTTCTTGGCATCTTTCATCCCACAGTAGTCCTGC

CCTTGCTCAGATCTGAAACCAGCAGATCTGCGTGCTGCCTGGCCCCAGACAAGGGAGGAAAACAAGGCCACGGTGGCCCCAATTGCTGTCCAGCACCTGC

CCGAGGCCAGACTCGGATCCAGTAATAGCTGCAGCTTCCCCTGTACCCCTGCCCTGGGTAACAATGGACCCATTTTCAGCCCAAGTAGAAAATACTGACA

TACAAAAATATATACATTTTAACCCCATATAAATTATTGATGGTGGACATAGAAAGCAGATGGTAGCTAGAGGGCAAGTATGCTGCAGAAACAAGAGAGG

TAATAACTTAGGGGACGGATAAAGGAGAAGTGTAGCTTAGCCCTC
Translation
 - UNI15458 - MAKPTSKDSGLKEKFKILLGLGTSRPNPRCAEGKQTEFIITSEILR - UNI15458 - ELSGECGLNNRIRMIGQICDVAKTKK

LEE - UNI15458 - HAVEALWKAVSDLLQPERPPEARHAVLTLLKAIVQGQ GDRLGVLRALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLE

EELA AEFVLQWMDVGLSSEFLLVLVNLVKFNSCYLDEYIASMVH HMICLLCIRTVSSVDIE VSLQVLDAVVCYNCLPAESLPLFIITLCRTINVKEL

CEPCWK LMRNLLGTHLGHSAIYNMCRIMEDR RSYMEDAPLLRGAVFFVGMALWGAHRLYSLKNSPTSVLPSFYE AMTCPNEVVSYEIVLSITRLIKK

YRKELQAVTWDILLDIIERLLQQLQ NLDSPELKTIVHDLLTTVEELCDQNEFHGSQERYYELVESYADQRP ESSLLNLISYRAQSIHPAKDGWIQNLQ

LLMERFFR RNECRSAVRIKVLDVLSFVLLINRQFYE EELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEK VMARSLSPP

PELEERDLAMHSASLEDVKTAVLGLLVILQ TKLYTLPASHATRVYESLISHIQLHYKHGYSLPIASSIRLQ AFDFLLLLRADSLHRLGLPNKDGVVRF

SPYCLCDCM MELDRASEKKASGPLSPPTGPPSPVPMGPAVRLGYLPYSLLFRVLLQCLKQ ESDWKVLKLVLSRLPESLRYKVLIFTSPCSVDQLSSAL

CSM LSAPKTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYLDKTRQ REMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISA

TASMAIPLLEFLST TLARLPHLYRNFAAEQYASVFAISLPYTNPSK KFNQYIVCLAHHVIAMWFIRCRLPFRKDFVPYITK GLRSNVLLSFDDTPEK

DSFRARSTSLNERPKS SLRIARAPKQGLNNSPPVKEFKESCAAEAFRCRSISVSEHVVRS SRIQTSLTSASLGSADENSMAQADDNLKNLHLELTETC

LDMMARYVFSNFTAVPKR RSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLLGLDSGDLQGGSDSS SSDPSTHVRQTKEAPAKLESQAGQQVSR

GARDRVRSMSG GGHGLRVGVLDTSAPYSPGGSASLGPQTAVAAKPEKPPAGAQLPTAEKTNLAAYVPLLTQGWAEILVRRPTG GNTSWLMSLENPLSP

FSSDINNMPLQELSNALMAAERFKEH GHGPVQVIVSASGW TAKPPTLPRSNTD DSAMVLEEGSPGETQVPVEPPELEDFEAALGTDRHCQRPDTYSR

 SSSASSQEEKSHLEELAAGGIPIERAISSEGARPAVDLSFQPSQPLSKSSSSPELQTLQDILGDLGDKIDIGRLSPEAKVRSQSGILDGEAATWSATGE

ESRITVPPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVERDNFKSRAAASSAEKVPGINPS SFVFLQLYHSPFFGDESNKPILLPNE SFERSVQ

LLDQIPSYDTHKIAVLYVGEGQ SSSELAILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQA AVFHIATLMPTKD

VDKHRCDKKRHLGNDFVSIIYNDSGEDFKLGTIK QGQFNFVHVIITPLDYKCNLLTLQCRKD DGPACKCEWWRQPGEIVVWALPVVMELTVTILLCHL

QMASQVHHSRSNPTDIYPSKWIARLRHIKRLRQR IREEVHYSNPSLPLMHPPAHTKAPAQAPEATPTYETGQRKRLISSVDDFTEFV
Transcript ENSMUST00000097374
Sequence
GTACGGGTTGCGCTTCCGGCAGCTGCCCTGGGCCGGGGGTGTGCGCCCTTCCCTGGGTGCAGGAGGACCTGCGCGCGAAAGGCGCGCGCGGG - UNI15

458 - AGCAGTTCTCTAGTACTGCCCTGCCCACCATGGCCAAACCAACAAGCAAAGATTCCGGCTTGAAGGAGAAGTTCAAGATACTGTTGGGATTGGG

AACATCGAGGCCAAATCCCAGGTGTGCAGAAGGCAAACAGACTGAGTTTATCATCACATCGGAAATCTTGAGA - UNI15458 - GAACTGAGTGGTG

AATGCGGCCTCAACAATCGCATCCGAATGATAGGGCAGATCTGTGATGTGGCAAAAACTAAGAAGCTTGAGGAG - UNI15458 - CATGCAGTGGAG

GCACTTTGGAAGGCTGTCTCAGACTTGCTACAGCCAGAGCGGCCACCAGAGGCCCGGCATGCAGTTCTCACCTTATTGAAGGCCATTGTACAGGGACAG 

GGTGATCGTTTGGGAGTTCTCAGAGCCCTCTTCTTCAAAGTGATCAAGGACTACCCCTCCAATGAAGACCTCCATGAAAGGCTAGAAGTTTTTAAGGCCC

TCACAGACAATGGGAGGCACATTACCTATTTGGAAGAAGAACTGG CAGAGTTTGTCCTGCAGTGGATGGATGTTGGCTTGTCCTCAGAATTCCTTCTGG

TACTTGTCAACCTGGTCAAGTTCAACAGCTGTTACCTTGACGAATACATTGCATCAATGGTTCA CATGATTTGTCTGCTATGCATCCGGACAGTGTCCT

CTGTGGACATTGAG GTGTCCTTGCAAGTGCTGGATGCTGTGGTCTGCTACAACTGCTTACCAGCCGAGAGCCTGCCTCTGTTCATTATCACCCTGTGCC

GCACCATCAATGTCAAGGAGCTGTGTGAGCCTTGCTGGAAG TTGATGCGTAACCTTCTGGGCACCCACCTGGGCCACAGCGCCATCTACAACATGTGCC

GCATCATGGAGGACAG ATCCTACATGGAAGATGCCCCACTGCTGAGAGGAGCTGTGTTCTTTGTAGGGATGGCACTCTGGGGAGCTCACCGGCTCTACT

CTCTCAAGAACTCCCCCACATCTGTGCTGCCGTCTTTTTATGAG GCTATGACCTGTCCCAATGAGGTGGTGTCATATGAGATTGTTCTGTCCATAACAA

GACTCATCAAGAAGTATAGGAAGGAGCTCCAGGCTGTGACATGGGATATTCTGCTGGACATCATTGAACGACTACTTCAGCAACTCCAG AACCTGGACA

GCCCGGAACTCAAGACCATCGTCCATGACCTGCTGACCACTGTGGAGGAGCTATGTGACCAGAACGAGTTCCATGGCTCGCAGGAAAGATACTATGAACT

GGTGGAGAGCTATGCAGACCAGAGACCT GAATCCTCTCTCTTAAACTTGATATCCTACAGAGCCCAGTCCATCCACCCTGCCAAGGATGGCTGGATCCA

GAACTTGCAGTTGTTGATGGAGAGGTTCTTCAG GAATGAGTGCCGCAGCGCCGTGCGCATCAAGGTGTTGGATGTTCTGTCCTTCGTGCTGCTGATCAA

CAGGCAGTTCTATGAG GAGGAGCTGATTAACTCGGTGGTCATCTCGCAGCTCTCCCACATTCCCGAGGATAAGGACCATCAGGTCCGAAAGCTGGCTAC

TCAGCTGCTGGTGGACCTGGCAGAGGGGTGCCACACCCACCACTTCAACAGTCTGCTGGACATCATTGAAAAG GTGATGGCGCGCTCACTCTCTCCACC

CCCGGAGCTGGAAGAAAGGGACCTGGCCATGCACTCGGCCTCCCTGGAGGACGTGAAGACCGCGGTCCTGGGGCTCCTGGTCATCCTTCAG ACCAAGCT

CTACACCTTGCCTGCCAGCCACGCCACTCGAGTGTATGAGAGCCTCATTAGTCACATCCAGCTCCATTACAAGCACGGCTACTCCCTGCCCATTGCTAGC

AGCATCCGACTACAG GCCTTTGACTTCCTGCTGCTACTGCGGGCTGACTCGCTGCATCGACTGGGCCTGCCCAACAAGGATGGGGTCGTGAGATTCAGC

CCTTACTGCCTCTGTGACTGCAT GGAACTGGATAGAGCCTCAGAGAAGAAAGCCAGTGGGCCCCTTTCACCTCCAACTGGGCCCCCTAGCCCTGTGCCT

ATGGGCCCTGCTGTGCGGCTCGGCTACCTACCCTACTCCCTGCTCTTCCGTGTCCTGTTGCAGTGTTTGAAGCAG GAGAGCGACTGGAAGGTGCTGAAG

CTGGTGCTCAGCAGGCTGCCGGAGTCACTGCGCTACAAAGTCCTCATCTTCACCTCCCCCTGCAGTGTCGACCAGCTGTCTTCTGCCCTCTGCTCCATG 

CTTTCAGCTCCAAAGACCCTTGAGCGGCTCCGAGGTACCCCAGAAGGCTTCTCGAGAACTGACCTGCACTTGGCTGTGGTTCCCGTGCTAACAGCATTAA

TATCTTATCACAACTATTTGGACAAGACCAGACAG CGTGAGATGGTGTACTGCCTGGAACAAGGCCTTATCTACCGCTGCGCCAGCCAGTGCGTGGTAG

CCTTGGCCATCTGCAGTGTGGAGATGCCCGACATCATCATCAAGGCGCTTCCTGTCCTGGTGGTGAAGCTCACACACATTTCTGCCACAGCCAGCATGGC

CATCCCGCTCCTGGAGTTCCTGTCTA CTTTGGCCAGGCTGCCCCACCTCTACAGGAACTTTGCTGCAGAGCAGTATGCCAGCGTGTTTGCCATCTCCTT

GCCATACACCAACCCCTCCAA GTTCAACCAGTACATTGTGTGTCTGGCTCACCACGTCATAGCCATGTGGTTCATCAGGTGCCGACTGCCCTTTCGGAA

GGATTTCGTCCCTTATATCACTAAG GGTTTGCGTTCCAATGTCCTCCTGTCTTTTGATGATACCCCTGAGAAGGACAGTTTCAGAGCACGGAGCACCAG

TCTTAATGAGAGACCCAAAAG TTTGAGGATAGCCAGAGCCCCCAAACAAGGCCTGAATAACTCTCCACCTGTGAAAGAATTCAAAGAGAGCTGTGCAGC

CGAGGCCTTCCGGTGCCGCAGCATCAGTGTATCTGAACATGTGGTCCGCAG CAGAATACAGACATCCCTTACGAGCGCCAGCCTGGGGTCTGCGGATGA

GAACTCTATGGCCCAGGCTGATGACAACTTGAAGAATCTCCACTTGGAGCTCACAGAAACATGTCTGGACATGATGGCCCGATATGTGTTCTCCAATTTC

ACTGCAGTCCCCAAGAG GTCCCCTGTGGGAGAGTTCCTCCTGGCAGGGGGTAGGACCAAAACCTGGCTGGTTGGAAACAAGCTTGTCACTGTGACAACA

AGTGTGGGAACTGGTACACGGTCGCTGCTGGGCCTGGACTCTGGGGACCTGCAGGGTGGCTCGGATTCAAG CTCTGATCCTAGCACACATGTGAGGCAG

ACAAAGGAAGCACCGGCCAAACTGGAGTCCCAGGCTGGGCAGCAGGTGTCCCGTGGGGCCCGGGACCGGGTCCGCTCCATGTCAG GGGGCCATGGCCTT

CGAGTTGGTGTCCTGGATACTTCAGCTCCCTATTCCCCAGGTGGCTCTGCTTCTCTGGGACCACAGACGGCGGTGGCAGCGAAGCCCGAGAAGCCCCCTG

CAGGAGCCCAGCTTCCAACAGCAGAGAAGACGAATCTGGCAGCCTATGTGCCTTTGTTAACCCAGGGCTGGGCAGAAATCTTAGTCCGCAGACCCACAG 

GAAACACCAGCTGGCTGATGAGCTTGGAGAACCCGCTCAGCCCCTTCTCCTCAGACATCAACAACATGCCCCTGCAAGAGCTGTCCAATGCCCTTATGGC

TGCTGAACGTTTCAAGGAGCACCGGGACACGGCCCTGTACAAGTCATTGTCAGTGCCAGCGGCTGGCACCGCCAAGCCTCCTACTCTCCCACGCTCTAAT

ACAG TGGCTTCTTTCTCCTCCCTGTACCAGCCCAGCTGCCAAGGACAGCTGCACAGGAGCGTTTCCTGGGCAG ACTCAGCCATGGTCCTTGAGGAGGG

AAGTCCAGGAGAGACTCAGGTGCCAGTGGAGCCCCCCGAATTGGAGGATTTCGAGGCGGCGTTAGGTACAGACAGGCACTGCCAGCGGCCTGACACCTAC

AGCCGG TCATCCTCAGCATCTAGCCAGGAAGAAAAGTCCCATTTGGAGGAGCTTGCTGCAGGGGGTATCCCCATTGAGCGGGCCATCTCCTCTGAGGGG

GCTCGGCCTGCCGTGGACCTCTCCTTCCAACCCTCACAGCCTTTGAGCAAGTCTAGCTCTTCTCCGGAGTTGCAGACCTTACAGGACATCCTTGGAGACC

TAGGGGACAAGATTGATATTGGACGGCTGAGTCCTGAGGCTAAGGTCCGGTCCCAGTCAGGGATCCTGGATGGGGAAGCAGCTACCTGGTCAGCTACGGG

TGAAGAGAGCCGTATCACAGTCCCACCTGAAGGTCCTCTGCCTTCCAGTTCTCCCCGCTCCCCCAGTGGCCTCCGGCCCCGAGGCTATACCATCTCTGAT

TCCGCTCCATCACGAAGGGGAAAGAGGGTAGAAAGGGATAACTTCAAGAGCAGAGCTGCGGCCTCCAGTGCTGAGAAGGTGCCAGGCATCAACCCTAG C

TTTGTGTTCCTACAGCTCTACCATTCGCCCTTTTTTGGTGATGAGTCCAATAAGCCCATCCTATTGCCCAATGAG TCCTTTGAACGGTCAGTACAGCTG

CTTGACCAGATTCCATCCTATGACACTCACAAGATTGCTGTCCTGTATGTGGGAGAAGGCCAG AGCAGCAGTGAGCTGGCCATCCTGTCAAATGAGCAT

GGCTCTTACAGGTACACGGAGTTTCTGACAGGCCTGGGTCGGCTTATTGAGCTCAAGGACTGCCAACCAGACAAGGTGTACTTAGGTGGACTGGATGTAT

GTGGCGAGGATGGACAGTTCACCTACTGCTGGCATGATGACATCATGCAAG CTGTTTTCCACATTGCCACCCTGATGCCCACCAAGGATGTGGACAAGC

ACCGCTGTGACAAGAAACGGCACCTGGGCAATGACTTTGTTTCTATCATCTACAATGATTCTGGTGAGGACTTCAAACTGGGCACCATTAAG GGCCAGT

TCAACTTTGTCCATGTGATCATCACACCGCTGGACTACAAGTGCAACCTATTGACCCTGCAGTGCAGGAAAG ACATGGAAGGCCTCGTGGACACCAGTG

TGGCCAAGATTGTGTCTGACCGCAACCTGTCCTTTGTGGCCCGACAGATGGCCCTGCATGCAAAT ATGGCCTCACAGGTACACCACAGCCGATCCAACC

CCACTGACATCTATCCCTCCAAGTGGATCGCAAGACTCCGCCACATTAAGCGTCTCCGCCAGAGG ATCCGTGAAGAGGTGCACTATTCCAACCCAAGCT

TGCCTCTGATGCACCCTCCAGCCCACACCAAAGCCCCAGCTCAAGCCCCTGAGGCTACACCCACCTATGAAACAGGCCAGCGGAAGCGCCTCATTTCCTC

CGTGGATGACTTCACAGAGTTTGTGTGAGGCCAGCAGATCCATGACTAGAGTCCTGTGGCCAGCCATGTAGCTATCCTGACTGTACTCCTACATGAAATA

AACTGCACACGCACATCTGGCCCGTGGAGTTCAGAGAGCAGCACAGACAGCAGTCAGACAGCTTCTTTATTTGACTTTGTCTTGTCTGTTTGGGGTTGGG

GCAGAATCCAGGCTAGAGCTGCAGATGAGCCCACAGAAGCAGGCAGGTGCCATCACATACATTCTCTTTCCCCCACCCGCCATGGGGGCAAGCCCCATTG

GTGGGCTTGTCCAGTAACTTCTTGGCATCTTTCATCCCACAGTAGTCCTGCCCTTGCTCAGATCTGAAACCAGCAGATCTGCGTGCTGCCTGGCCCCAGA

CAAGGGAGGAAAACAAGGCCACGGTGGCCCCAATTGCTGTCCAGCACCTGCCCGAGGCCAGACTCGGATCCAGTAATAGCTGCAGCTTCCCCTGTACCCC

TGCCCTGGGTAACAATGGACCCATTTTCAGCCCAAGTAGAAAATACTGACATACAAAAATATATACATTTTAACCCCATATAAATTATTGATGGTGGACA

TAGAAAGCAGATGGTAGCTAGAGGGCAAGTATGCTGCAGAAACAAGAGAGGTAATAACTTAGGGGACGGATAAAGGAGAAGTGTAGCTTAGCCCTC
Translation
 - UNI15458 - MAKPTSKDSGLKEKFKILLGLGTSRPNPRCAEGKQTEFIITSEILR - UNI15458 - ELSGECGLNNRIRMIGQICDVAKTKK

LEE - UNI15458 - HAVEALWKAVSDLLQPERPPEARHAVLTLLKAIVQGQ GDRLGVLRALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLE

EELA AEFVLQWMDVGLSSEFLLVLVNLVKFNSCYLDEYIASMVH HMICLLCIRTVSSVDIE VSLQVLDAVVCYNCLPAESLPLFIITLCRTINVKEL

CEPCWK LMRNLLGTHLGHSAIYNMCRIMEDR RSYMEDAPLLRGAVFFVGMALWGAHRLYSLKNSPTSVLPSFYE AMTCPNEVVSYEIVLSITRLIKK

YRKELQAVTWDILLDIIERLLQQLQ NLDSPELKTIVHDLLTTVEELCDQNEFHGSQERYYELVESYADQRP ESSLLNLISYRAQSIHPAKDGWIQNLQ

LLMERFFR RNECRSAVRIKVLDVLSFVLLINRQFYE EELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEK VMARSLSPP

PELEERDLAMHSASLEDVKTAVLGLLVILQ TKLYTLPASHATRVYESLISHIQLHYKHGYSLPIASSIRLQ AFDFLLLLRADSLHRLGLPNKDGVVRF

SPYCLCDCM MELDRASEKKASGPLSPPTGPPSPVPMGPAVRLGYLPYSLLFRVLLQCLKQ ESDWKVLKLVLSRLPESLRYKVLIFTSPCSVDQLSSAL

CSM LSAPKTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYLDKTRQ REMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISA

TASMAIPLLEFLST TLARLPHLYRNFAAEQYASVFAISLPYTNPSK KFNQYIVCLAHHVIAMWFIRCRLPFRKDFVPYITK GLRSNVLLSFDDTPEK

DSFRARSTSLNERPKS SLRIARAPKQGLNNSPPVKEFKESCAAEAFRCRSISVSEHVVRS SRIQTSLTSASLGSADENSMAQADDNLKNLHLELTETC

LDMMARYVFSNFTAVPKR RSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLLGLDSGDLQGGSDSS SSDPSTHVRQTKEAPAKLESQAGQQVSR

GARDRVRSMSG GGHGLRVGVLDTSAPYSPGGSASLGPQTAVAAKPEKPPAGAQLPTAEKTNLAAYVPLLTQGWAEILVRRPTG GNTSWLMSLENPLSP

FSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSVPAAGTAKPPTLPRSNTV VASFSSLYQPSCQGQLHRSVSWAD DSAMVLEEGSPGETQVPVEP

PELEDFEAALGTDRHCQRPDTYSR SSSASSQEEKSHLEELAAGGIPIERAISSEGARPAVDLSFQPSQPLSKSSSSPELQTLQDILGDLGDKIDIGRLS

PEAKVRSQSGILDGEAATWSATGEESRITVPPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVERDNFKSRAAASSAEKVPGINPS SFVFLQLYHS

PFFGDESNKPILLPNE SFERSVQLLDQIPSYDTHKIAVLYVGEGQ SSSELAILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFT

YCWHDDIMQA AVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIIYNDSGEDFKLGTIK GQFNFVHVIITPLDYKCNLLTLQCRKD DMEGLVDTSVAKI

VSDRNLSFVARQMALHAN MASQVHHSRSNPTDIYPSKWIARLRHIKRLRQR IREEVHYSNPSLPLMHPPAHTKAPAQAPEATPTYETGQRKRLISSVD

DFTEFV
Transcript ENSMUST00000088420
Sequence
GTACGGGTTGCGCTTCCGGCAGCTGCCCTGGGCCGGGGGTGTGCGCCCTTCCCTGGGTGCAGGAGGACCTGCGCGCGAAAGGCGCGCGCGGG - UNI15

458 - AGCAGTTCTCTAGTACTGCCCTGCCCACCATGGCCAAACCAACAAGCAAAGATTCCGGCTTGAAGGAGAAGTTCAAGATACTGTTGGGATTGGG

AACATCGAGGCCAAATCCCAGGTGTGCAGAAGGCAAACAGACTGAGTTTATCATCACATCGGAAATCTTGAGA - UNI15458 - GAACTGAGTGGTG

AATGCGGCCTCAACAATCGCATCCGAATGATAGGGCAGATCTGTGATGTGGCAAAAACTAAGAAGCTTGAGGAG - UNI15458 - CATGCAGTGGAG

GCACTTTGGAAGGCTGTCTCAGACTTGCTACAGCCAGAGCGGCCACCAGAGGCCCGGCATGCAGTTCTCACCTTATTGAAGGCCATTGTACAGGGACAG 

GGTGATCGTTTGGGAGTTCTCAGAGCCCTCTTCTTCAAAGTGATCAAGGACTACCCCTCCAATGAAGACCTCCATGAAAGGCTAGAAGTTTTTAAGGCCC

TCACAGACAATGGGAGGCACATTACCTATTTGGAAGAAGAACTGG CAGAGTTTGTCCTGCAGTGGATGGATGTTGGCTTGTCCTCAGAATTCCTTCTGG

TACTTGTCAACCTGGTCAAGTTCAACAGCTGTTACCTTGACGAATACATTGCATCAATGGTTCA CATGATTTGTCTGCTATGCATCCGGACAGTGTCCT

CTGTGGACATTGAG GTGTCCTTGCAAGTGCTGGATGCTGTGGTCTGCTACAACTGCTTACCAGCCGAGAGCCTGCCTCTGTTCATTATCACCCTGTGCC

GCACCATCAATGTCAAGGAGCTGTGTGAGCCTTGCTGGAAG TTGATGCGTAACCTTCTGGGCACCCACCTGGGCCACAGCGCCATCTACAACATGTGCC

GCATCATGGAGGACAG ATCCTACATGGAAGATGCCCCACTGCTGAGAGGAGCTGTGTTCTTTGTAGGGATGGCACTCTGGGGAGCTCACCGGCTCTACT

CTCTCAAGAACTCCCCCACATCTGTGCTGCCGTCTTTTTATGAG GCTATGACCTGTCCCAATGAGGTGGTGTCATATGAGATTGTTCTGTCCATAACAA

GACTCATCAAGAAGTATAGGAAGGAGCTCCAGGCTGTGACATGGGATATTCTGCTGGACATCATTGAACGACTACTTCAGCAACTCCAG AACCTGGACA

GCCCGGAACTCAAGACCATCGTCCATGACCTGCTGACCACTGTGGAGGAGCTATGTGACCAGAACGAGTTCCATGGCTCGCAGGAAAGATACTATGAACT

GGTGGAGAGCTATGCAGACCAGAGACCT GAATCCTCTCTCTTAAACTTGATATCCTACAGAGCCCAGTCCATCCACCCTGCCAAGGATGGCTGGATCCA

GAACTTGCAGTTGTTGATGGAGAGGTTCTTCAG GAATGAGTGCCGCAGCGCCGTGCGCATCAAGGTGTTGGATGTTCTGTCCTTCGTGCTGCTGATCAA

CAGGCAGTTCTATGAG GAGGAGCTGATTAACTCGGTGGTCATCTCGCAGCTCTCCCACATTCCCGAGGATAAGGACCATCAGGTCCGAAAGCTGGCTAC

TCAGCTGCTGGTGGACCTGGCAGAGGGGTGCCACACCCACCACTTCAACAGTCTGCTGGACATCATTGAAAAG GTGATGGCGCGCTCACTCTCTCCACC

CCCGGAGCTGGAAGAAAGGGACCTGGCCATGCACTCGGCCTCCCTGGAGGACGTGAAGACCGCGGTCCTGGGGCTCCTGGTCATCCTTCAG ACCAAGCT

CTACACCTTGCCTGCCAGCCACGCCACTCGAGTGTATGAGAGCCTCATTAGTCACATCCAGCTCCATTACAAGCACGGCTACTCCCTGCCCATTGCTAGC

AGCATCCGACTACAG GCCTTTGACTTCCTGCTGCTACTGCGGGCTGACTCGCTGCATCGACTGGGCCTGCCCAACAAGGATGGGGTCGTGAGATTCAGC

CCTTACTGCCTCTGTGACTGCAT GGAACTGGATAGAGCCTCAGAGAAGAAAGCCAGTGGGCCCCTTTCACCTCCAACTGGGCCCCCTAGCCCTGTGCCT

ATGGGCCCTGCTGTGCGGCTCGGCTACCTACCCTACTCCCTGCTCTTCCGTGTCCTGTTGCAGTGTTTGAAGCAG GAGAGCGACTGGAAGGTGCTGAAG

CTGGTGCTCAGCAGGCTGCCGGAGTCACTGCGCTACAAAGTCCTCATCTTCACCTCCCCCTGCAGTGTCGACCAGCTGTCTTCTGCCCTCTGCTCCATG 

CTTTCAGCTCCAAAGACCCTTGAGCGGCTCCGAGGTACCCCAGAAGGCTTCTCGAGAACTGACCTGCACTTGGCTGTGGTTCCCGTGCTAACAGCATTAA

TATCTTATCACAACTATTTGGACAAGACCAGACAG CGTGAGATGGTGTACTGCCTGGAACAAGGCCTTATCTACCGCTGCGCCAGCCAGTGCGTGGTAG

CCTTGGCCATCTGCAGTGTGGAGATGCCCGACATCATCATCAAGGCGCTTCCTGTCCTGGTGGTGAAGCTCACACACATTTCTGCCACAGCCAGCATGGC

CATCCCGCTCCTGGAGTTCCTGTCTA CTTTGGCCAGGCTGCCCCACCTCTACAGGAACTTTGCTGCAGAGCAGTATGCCAGCGTGTTTGCCATCTCCTT

GCCATACACCAACCCCTCCAA GTTCAACCAGTACATTGTGTGTCTGGCTCACCACGTCATAGCCATGTGGTTCATCAGGTGCCGACTGCCCTTTCGGAA

GGATTTCGTCCCTTATATCACTAAG GGTTTGCGTTCCAATGTCCTCCTGTCTTTTGATGATACCCCTGAGAAGGACAGTTTCAGAGCACGGAGCACCAG

TCTTAATGAGAGACCCAAAAG TTTGAGGATAGCCAGAGCCCCCAAACAAGGCCTGAATAACTCTCCACCTGTGAAAGAATTCAAAGAGAGCTGTGCAGC

CGAGGCCTTCCGGTGCCGCAGCATCAGTGTATCTGAACATGTGGTCCGCAG CAGAATACAGACATCCCTTACGAGCGCCAGCCTGGGGTCTGCGGATGA

GAACTCTATGGCCCAGGCTGATGACAACTTGAAGAATCTCCACTTGGAGCTCACAGAAACATGTCTGGACATGATGGCCCGATATGTGTTCTCCAATTTC

ACTGCAGTCCCCAAGAG GTCCCCTGTGGGAGAGTTCCTCCTGGCAGGGGGTAGGACCAAAACCTGGCTGGTTGGAAACAAGCTTGTCACTGTGACAACA

AGTGTGGGAACTGGTACACGGTCGCTGCTGGGCCTGGACTCTGGGGACCTGCAGGGTGGCTCGGATTCAAG CTCTGATCCTAGCACACATGTGAGGCAG

ACAAAGGAAGCACCGGCCAAACTGGAGTCCCAGGCTGGGCAGCAGGTGTCCCGTGGGGCCCGGGACCGGGTCCGCTCCATGTCAG GGGGCCATGGCCTT

CGAGTTGGTGTCCTGGATACTTCAGCTCCCTATTCCCCAGGTGGCTCTGCTTCTCTGGGACCACAGACGGCGGTGGCAGCGAAGCCCGAGAAGCCCCCTG

CAGGAGCCCAGCTTCCAACAGCAGAGAAGACGAATCTGGCAGCCTATGTGCCTTTGTTAACCCAGGGCTGGGCAGAAATCTTAGTCCGCAGACCCACAG 

GAAACACCAGCTGGCTGATGAGCTTGGAGAACCCGCTCAGCCCCTTCTCCTCAGACATCAACAACATGCCCCTGCAAGAGCTGTCCAATGCCCTTATGGC

TGCTGAACGTTTCAAGGAGCAC GGACACGGCCCTGTACAAGTCATTGTCAGTGCCAGCGGCTGG ACCGCCAAGCCTCCTACTCTCCCACGCTCTAATA

CAG TGGCTTCTTTCTCCTCCCTGTACCAGCCCAGCTGCCAAGGACAGCTGCACAGGAGCGTTTCCTGGGCAG ACTCAGCCATGGTCCTTGAGGAGGGA

AGTCCAGGAGAGACTCAGGTGCCAGTGGAGCCCCCCGAATTGGAGGATTTCGAGGCGGCGTTAGGTACAGACAGGCACTGCCAGCGGCCTGACACCTACA

GCCGG TCATCCTCAGCATCTAGCCAGGAAGAAAAGTCCCATTTGGAGGAGCTTGCTGCAGGGGGTATCCCCATTGAGCGGGCCATCTCCTCTGAGGGGG

CTCGGCCTGCCGTGGACCTCTCCTTCCAACCCTCACAGCCTTTGAGCAAGTCTAGCTCTTCTCCGGAGTTGCAGACCTTACAGGACATCCTTGGAGACCT

AGGGGACAAGATTGATATTGGACGGCTGAGTCCTGAGGCTAAGGTCCGGTCCCAGTCAGGGATCCTGGATGGGGAAGCAGCTACCTGGTCAGCTACGGGT

GAAGAGAGCCGTATCACAGTCCCACCTGAAGGTCCTCTGCCTTCCAGTTCTCCCCGCTCCCCCAGTGGCCTCCGGCCCCGAGGCTATACCATCTCTGATT

CCGCTCCATCACGAAGGGGAAAGAGGGTAGAAAGGGATAACTTCAAGAGCAGAGCTGCGGCCTCCAGTGCTGAGAAGGTGCCAGGCATCAACCCTAG CT

TTGTGTTCCTACAGCTCTACCATTCGCCCTTTTTTGGTGATGAGTCCAATAAGCCCATCCTATTGCCCAATGAG TCCTTTGAACGGTCAGTACAGCTGC

TTGACCAGATTCCATCCTATGACACTCACAAGATTGCTGTCCTGTATGTGGGAGAAGGCCAG AGCAGCAGTGAGCTGGCCATCCTGTCAAATGAGCATG

GCTCTTACAGGTACACGGAGTTTCTGACAGGCCTGGGTCGGCTTATTGAGCTCAAGGACTGCCAACCAGACAAGGTGTACTTAGGTGGACTGGATGTATG

TGGCGAGGATGGACAGTTCACCTACTGCTGGCATGATGACATCATGCAAG CTGTTTTCCACATTGCCACCCTGATGCCCACCAAGGATGTGGACAAGCA

CCGCTGTGACAAGAAACGGCACCTGGGCAATGACTTTGTTTCTATCATCTACAATGATTCTGGTGAGGACTTCAAACTGGGCACCATTAAG CAGGGCCA

GTTCAACTTTGTCCATGTGATCATCACACCGCTGGACTACAAGTGCAACCTATTGACCCTGCAGTGCAGGAAAG ATGGCCCTGCATGCAAATGTGAGTG

GTGGCGGCAGCCTGGGGAGATAGTCGTGTGGGCGCTCCCTGTTGTGATGGAGCTCACTGTCACCATCCTGCTCTGTCACCTCCAGATGGCCTCACAGGTA

CACCACAGCCGATCCAACCCCACTGACATCTATCCCTCCAAGTGGATCGCAAGACTCCGCCACATTAAGCGTCTCCGCCAGAGG ATCCGTGAAGAGGTG

CACTATTCCAACCCAAGCTTGCCTCTGATGCACCCTCCAGCCCACACCAAAGCCCCAGCTCAAGCCCCTGAGGCTACACCCACCTATGAAACAGGCCAGC

GGAAGCGCCTCATTTCCTCCGTGGATGACTTCACAGAGTTTGTGTGAGGCCAGCAGATCCATGACTAGAGTCCTGTGGCCAGCCATGTAGCTATCCTGAC

TGTACTCCTACATGAAATAAACTGCACACGCACATCTGGCCCGTGGAGTTCAGAGAGCAGCACAGACAGCAGTCAGACAGCTTCTTTATTTGACTTTGTC

TTGTCTGTTTGGGGTTGGGGCAGAATCCAGGCTAGAGCTGCAGATGAGCCCACAGAAGCAGGCAGGTGCCATCACATACATTCTCTTTCCCCCACCCGCC

ATGGGGGCAAGCCCCATTGGTGGGCTTGTCCAGTAACTTCTTGGCATCTTTCATCCCACAGTAGTCCTGCCCTTGCTCAGATCTGAAACCAGCAGATCTG

CGTGCTGCCTGGCCCCAGACAAGGGAGGAAAACAAGGCCACGGTGGCCCCAATTGCTGTCCAGCACCTGCCCGAGGCCAGACTCGGATCCAGTAATAGCT

GCAGCTTCCCCTGTACCCCTGCCCTGGGTAACAATGGACCCATTTTCAGCCCAAGTAGAAAATACTGACATACAAAAATATATACATTTTAACCCCATAT

AAATTATTGATGGTGGACATAGAAAGCAGATGGTAGCTAGAGGGCAAGTATGCTGCAGAAACAAGAGAGGTAATAACTTAGGGGACGGATAAAGGAGAAG

TGTAGCTTAGCCCTC
Translation
 - UNI15458 - MAKPTSKDSGLKEKFKILLGLGTSRPNPRCAEGKQTEFIITSEILR - UNI15458 - ELSGECGLNNRIRMIGQICDVAKTKK

LEE - UNI15458 - HAVEALWKAVSDLLQPERPPEARHAVLTLLKAIVQGQ GDRLGVLRALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLE

EELA AEFVLQWMDVGLSSEFLLVLVNLVKFNSCYLDEYIASMVH HMICLLCIRTVSSVDIE VSLQVLDAVVCYNCLPAESLPLFIITLCRTINVKEL

CEPCWK LMRNLLGTHLGHSAIYNMCRIMEDR RSYMEDAPLLRGAVFFVGMALWGAHRLYSLKNSPTSVLPSFYE AMTCPNEVVSYEIVLSITRLIKK

YRKELQAVTWDILLDIIERLLQQLQ NLDSPELKTIVHDLLTTVEELCDQNEFHGSQERYYELVESYADQRP ESSLLNLISYRAQSIHPAKDGWIQNLQ

LLMERFFR RNECRSAVRIKVLDVLSFVLLINRQFYE EELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEK VMARSLSPP

PELEERDLAMHSASLEDVKTAVLGLLVILQ TKLYTLPASHATRVYESLISHIQLHYKHGYSLPIASSIRLQ AFDFLLLLRADSLHRLGLPNKDGVVRF

SPYCLCDCM MELDRASEKKASGPLSPPTGPPSPVPMGPAVRLGYLPYSLLFRVLLQCLKQ ESDWKVLKLVLSRLPESLRYKVLIFTSPCSVDQLSSAL

CSM LSAPKTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYLDKTRQ REMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISA

TASMAIPLLEFLST TLARLPHLYRNFAAEQYASVFAISLPYTNPSK KFNQYIVCLAHHVIAMWFIRCRLPFRKDFVPYITK GLRSNVLLSFDDTPEK

DSFRARSTSLNERPKS SLRIARAPKQGLNNSPPVKEFKESCAAEAFRCRSISVSEHVVRS SRIQTSLTSASLGSADENSMAQADDNLKNLHLELTETC

LDMMARYVFSNFTAVPKR RSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLLGLDSGDLQGGSDSS SSDPSTHVRQTKEAPAKLESQAGQQVSR

GARDRVRSMSG GGHGLRVGVLDTSAPYSPGGSASLGPQTAVAAKPEKPPAGAQLPTAEKTNLAAYVPLLTQGWAEILVRRPTG GNTSWLMSLENPLSP

FSSDINNMPLQELSNALMAAERFKEH GHGPVQVIVSASGW TAKPPTLPRSNTV VASFSSLYQPSCQGQLHRSVSWAD DSAMVLEEGSPGETQVPVE

PPELEDFEAALGTDRHCQRPDTYSR SSSASSQEEKSHLEELAAGGIPIERAISSEGARPAVDLSFQPSQPLSKSSSSPELQTLQDILGDLGDKIDIGRL

SPEAKVRSQSGILDGEAATWSATGEESRITVPPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVERDNFKSRAAASSAEKVPGINPS SFVFLQLYH

SPFFGDESNKPILLPNE SFERSVQLLDQIPSYDTHKIAVLYVGEGQ SSSELAILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQF

TYCWHDDIMQA AVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIIYNDSGEDFKLGTIK QGQFNFVHVIITPLDYKCNLLTLQCRKD DGPACKCEWWR

QPGEIVVWALPVVMELTVTILLCHLQMASQVHHSRSNPTDIYPSKWIARLRHIKRLRQR IREEVHYSNPSLPLMHPPAHTKAPAQAPEATPTYETGQRK

RLISSVDDFTEFV

For any suggestions or comments, please send an email to unitrap@crg.es